Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V6RR48

Protein Details
Accession A0A1V6RR48    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
10-51PPPPPPPPSRSNKEKKKEWCAAIKKGKRERKKARRARIDAIFBasic
NLS Segment(s)
PositionSequence
12-46PPPPPPSRSNKEKKKEWCAAIKKGKRERKKARRAR
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MAETSADAPPPPPPPPPSRSNKEKKKEWCAAIKKGKRERKKARRARIDAIFNALKDHYNAMGGPNQPAAGSDTIRVLREWAEILEERNPHIHVKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.39
3 0.47
4 0.52
5 0.56
6 0.64
7 0.7
8 0.75
9 0.77
10 0.81
11 0.82
12 0.82
13 0.82
14 0.78
15 0.77
16 0.74
17 0.75
18 0.76
19 0.73
20 0.73
21 0.74
22 0.78
23 0.77
24 0.81
25 0.82
26 0.82
27 0.88
28 0.89
29 0.89
30 0.9
31 0.87
32 0.83
33 0.78
34 0.72
35 0.61
36 0.56
37 0.46
38 0.35
39 0.3
40 0.23
41 0.17
42 0.13
43 0.13
44 0.08
45 0.08
46 0.08
47 0.09
48 0.12
49 0.12
50 0.13
51 0.12
52 0.12
53 0.11
54 0.12
55 0.13
56 0.11
57 0.11
58 0.1
59 0.13
60 0.15
61 0.16
62 0.15
63 0.14
64 0.13
65 0.14
66 0.14
67 0.11
68 0.14
69 0.14
70 0.16
71 0.21
72 0.2
73 0.21
74 0.23
75 0.24
76 0.26