Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V6Q2Z4

Protein Details
Accession A0A1V6Q2Z4   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-39DSDIRPTKTQGRKRKRVSVACRSCRVRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MADQRPQSSTPGDSDIRPTKTQGRKRKRVSVACRSCRVRKSRCDGARPCSTCEVMDTECRYEQPYSQPVAITNGSSERQEESLLEQRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.36
3 0.38
4 0.37
5 0.37
6 0.41
7 0.49
8 0.58
9 0.62
10 0.65
11 0.71
12 0.78
13 0.85
14 0.85
15 0.85
16 0.85
17 0.85
18 0.85
19 0.81
20 0.81
21 0.76
22 0.72
23 0.69
24 0.68
25 0.64
26 0.61
27 0.62
28 0.65
29 0.65
30 0.68
31 0.65
32 0.63
33 0.65
34 0.59
35 0.54
36 0.46
37 0.41
38 0.32
39 0.29
40 0.25
41 0.18
42 0.2
43 0.2
44 0.19
45 0.19
46 0.2
47 0.21
48 0.19
49 0.2
50 0.22
51 0.25
52 0.25
53 0.25
54 0.25
55 0.24
56 0.27
57 0.26
58 0.2
59 0.16
60 0.17
61 0.17
62 0.18
63 0.18
64 0.16
65 0.16
66 0.17
67 0.16
68 0.19