Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V6Q4N0

Protein Details
Accession A0A1V6Q4N0    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-37NKELRAANEKQKQKRTRSRRQIPAEEGHydrophilic
NLS Segment(s)
PositionSequence
21-28QKQKRTRS
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 7.5, mito 2
Family & Domain DBs
Amino Acid Sequences MQGAILLAKENKELRAANEKQKQKRTRSRRQIPAEEGLSVQEASALIMQQQEAIEAPPPGPGMSGESTIQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.32
3 0.36
4 0.42
5 0.49
6 0.57
7 0.61
8 0.7
9 0.74
10 0.74
11 0.8
12 0.81
13 0.83
14 0.86
15 0.87
16 0.88
17 0.88
18 0.84
19 0.78
20 0.72
21 0.62
22 0.51
23 0.41
24 0.31
25 0.23
26 0.16
27 0.11
28 0.06
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.06
37 0.06
38 0.06
39 0.06
40 0.07
41 0.08
42 0.08
43 0.08
44 0.09
45 0.1
46 0.09
47 0.09
48 0.09
49 0.12
50 0.14
51 0.16