Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V6RKJ0

Protein Details
Accession A0A1V6RKJ0   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MTFREKVKRVFRSPKKEGKPKIEYYRRHECPBasic
NLS Segment(s)
PositionSequence
7-21VKRVFRSPKKEGKPK
Subcellular Location(s) mito 12, nucl 8.5, cyto_nucl 8.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MTFREKVKRVFRSPKKEGKPKIEYYRRHECPPSKFRGPFDRAHQKSLAAWSFQGATVERTRSFEISVSPCATYEGSDGYSGPSDSDNSVSPDDVDPAAPHSEAPAESSPRGPDSGSQSSTVVDPASYNGSMMTLINEGSIYEIPEDSKDPKFFLKESIRYSSPLVHAISPAMTPCVMSARKDLPFAPEDLARALIAVQVCA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.89
4 0.88
5 0.87
6 0.85
7 0.84
8 0.86
9 0.85
10 0.83
11 0.8
12 0.82
13 0.76
14 0.74
15 0.73
16 0.69
17 0.7
18 0.7
19 0.71
20 0.69
21 0.68
22 0.68
23 0.69
24 0.66
25 0.62
26 0.63
27 0.66
28 0.59
29 0.6
30 0.55
31 0.46
32 0.43
33 0.45
34 0.37
35 0.27
36 0.24
37 0.21
38 0.2
39 0.2
40 0.19
41 0.12
42 0.13
43 0.15
44 0.18
45 0.18
46 0.2
47 0.21
48 0.2
49 0.2
50 0.18
51 0.19
52 0.19
53 0.22
54 0.2
55 0.19
56 0.18
57 0.18
58 0.18
59 0.14
60 0.11
61 0.09
62 0.09
63 0.09
64 0.09
65 0.08
66 0.09
67 0.08
68 0.08
69 0.07
70 0.07
71 0.07
72 0.09
73 0.09
74 0.1
75 0.11
76 0.1
77 0.11
78 0.1
79 0.11
80 0.09
81 0.09
82 0.06
83 0.08
84 0.09
85 0.08
86 0.07
87 0.06
88 0.07
89 0.07
90 0.09
91 0.09
92 0.1
93 0.11
94 0.12
95 0.13
96 0.13
97 0.13
98 0.11
99 0.11
100 0.17
101 0.21
102 0.21
103 0.21
104 0.21
105 0.21
106 0.21
107 0.19
108 0.12
109 0.07
110 0.06
111 0.06
112 0.08
113 0.08
114 0.08
115 0.07
116 0.07
117 0.07
118 0.07
119 0.07
120 0.05
121 0.05
122 0.05
123 0.05
124 0.05
125 0.06
126 0.07
127 0.06
128 0.06
129 0.07
130 0.07
131 0.08
132 0.11
133 0.12
134 0.17
135 0.17
136 0.19
137 0.22
138 0.24
139 0.24
140 0.3
141 0.36
142 0.38
143 0.42
144 0.46
145 0.44
146 0.44
147 0.45
148 0.4
149 0.34
150 0.31
151 0.28
152 0.22
153 0.21
154 0.2
155 0.19
156 0.15
157 0.14
158 0.11
159 0.09
160 0.09
161 0.09
162 0.15
163 0.16
164 0.17
165 0.22
166 0.26
167 0.29
168 0.31
169 0.31
170 0.3
171 0.3
172 0.3
173 0.28
174 0.24
175 0.23
176 0.22
177 0.23
178 0.17
179 0.15
180 0.13
181 0.13