Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V6R5T9

Protein Details
Accession A0A1V6R5T9    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MGNRKGKNKGKGRGKKRSRSPKENKIATKVBasic
NLS Segment(s)
PositionSequence
4-25RKGKNKGKGRGKKRSRSPKENK
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MGNRKGKNKGKGRGKKRSRSPKENKIATKVATTGENKGHVVQCPIHPGSFPRRLKDCVQCISAERRLVQQERKEKMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.91
4 0.92
5 0.91
6 0.91
7 0.91
8 0.91
9 0.9
10 0.89
11 0.82
12 0.77
13 0.71
14 0.61
15 0.52
16 0.42
17 0.33
18 0.29
19 0.26
20 0.22
21 0.2
22 0.2
23 0.19
24 0.2
25 0.2
26 0.16
27 0.17
28 0.15
29 0.14
30 0.18
31 0.19
32 0.17
33 0.16
34 0.18
35 0.24
36 0.32
37 0.34
38 0.34
39 0.37
40 0.41
41 0.47
42 0.53
43 0.52
44 0.47
45 0.46
46 0.43
47 0.42
48 0.45
49 0.44
50 0.38
51 0.33
52 0.33
53 0.39
54 0.45
55 0.5
56 0.52
57 0.56