Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I4YII8

Protein Details
Accession I4YII8    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
49-71IETVKAPKKYKRVLSFNRKIDNYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto 5.5, cyto_mito 3.5
Family & Domain DBs
KEGG wse:WALSEDRAFT_62449  -  
Amino Acid Sequences MNTIEYSVADLSKIKFRLDFICELNILTLSDKALPLCEFNYYKLNERLIETVKAPKKYKRVLSFNRKIDNYSLTKNPETNEFDLHINASKAVNNFYTGRVGKLVGNEDYYKIHTDIKNVKLISQMPQLPSLATSKYSFNDAERATYLRFYLNDVAVPSSNSNFENFSNWLNITLLRFSESRYERRVRKLIDSYRLPSTEETQRQDLALHQWKGGLLDSEDVYDYLTKLPLDDTSLLCIQIKGYNHSPSAWSTYKDFRRFHSHTDSPTQSIFFLNGKFLISDEYSVNRFKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.26
4 0.31
5 0.34
6 0.36
7 0.31
8 0.34
9 0.32
10 0.31
11 0.29
12 0.24
13 0.19
14 0.15
15 0.13
16 0.1
17 0.12
18 0.12
19 0.11
20 0.13
21 0.13
22 0.14
23 0.14
24 0.19
25 0.19
26 0.2
27 0.27
28 0.27
29 0.33
30 0.36
31 0.38
32 0.34
33 0.35
34 0.37
35 0.34
36 0.34
37 0.29
38 0.34
39 0.37
40 0.43
41 0.45
42 0.48
43 0.53
44 0.59
45 0.66
46 0.67
47 0.71
48 0.74
49 0.81
50 0.84
51 0.83
52 0.83
53 0.74
54 0.67
55 0.59
56 0.55
57 0.48
58 0.43
59 0.4
60 0.37
61 0.38
62 0.38
63 0.36
64 0.36
65 0.37
66 0.34
67 0.31
68 0.28
69 0.26
70 0.25
71 0.25
72 0.2
73 0.15
74 0.14
75 0.12
76 0.13
77 0.13
78 0.14
79 0.14
80 0.14
81 0.15
82 0.15
83 0.21
84 0.18
85 0.18
86 0.17
87 0.18
88 0.17
89 0.18
90 0.2
91 0.15
92 0.17
93 0.16
94 0.17
95 0.17
96 0.17
97 0.16
98 0.14
99 0.19
100 0.17
101 0.23
102 0.29
103 0.31
104 0.35
105 0.33
106 0.32
107 0.3
108 0.31
109 0.28
110 0.26
111 0.26
112 0.21
113 0.23
114 0.22
115 0.19
116 0.19
117 0.17
118 0.12
119 0.11
120 0.11
121 0.11
122 0.11
123 0.14
124 0.13
125 0.13
126 0.17
127 0.16
128 0.16
129 0.15
130 0.16
131 0.14
132 0.14
133 0.14
134 0.1
135 0.1
136 0.11
137 0.12
138 0.11
139 0.11
140 0.11
141 0.12
142 0.11
143 0.11
144 0.1
145 0.08
146 0.09
147 0.09
148 0.09
149 0.1
150 0.1
151 0.12
152 0.13
153 0.13
154 0.13
155 0.13
156 0.13
157 0.12
158 0.12
159 0.1
160 0.1
161 0.09
162 0.1
163 0.1
164 0.1
165 0.18
166 0.21
167 0.24
168 0.29
169 0.36
170 0.39
171 0.47
172 0.53
173 0.47
174 0.51
175 0.56
176 0.57
177 0.58
178 0.58
179 0.53
180 0.51
181 0.49
182 0.43
183 0.35
184 0.33
185 0.33
186 0.34
187 0.35
188 0.33
189 0.32
190 0.31
191 0.3
192 0.28
193 0.28
194 0.31
195 0.28
196 0.26
197 0.26
198 0.26
199 0.26
200 0.25
201 0.18
202 0.1
203 0.11
204 0.11
205 0.11
206 0.11
207 0.1
208 0.1
209 0.09
210 0.09
211 0.08
212 0.09
213 0.08
214 0.08
215 0.09
216 0.09
217 0.12
218 0.14
219 0.14
220 0.16
221 0.17
222 0.18
223 0.17
224 0.17
225 0.14
226 0.16
227 0.18
228 0.19
229 0.24
230 0.28
231 0.28
232 0.29
233 0.3
234 0.28
235 0.33
236 0.3
237 0.27
238 0.27
239 0.36
240 0.45
241 0.51
242 0.51
243 0.49
244 0.56
245 0.58
246 0.61
247 0.61
248 0.58
249 0.55
250 0.62
251 0.6
252 0.53
253 0.51
254 0.45
255 0.35
256 0.31
257 0.28
258 0.22
259 0.19
260 0.18
261 0.17
262 0.17
263 0.16
264 0.16
265 0.17
266 0.15
267 0.16
268 0.16
269 0.19
270 0.21