Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V6RGP1

Protein Details
Accession A0A1V6RGP1    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
28-54AFASNRNPARRPPQRPRPQSWHPYGPVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
Amino Acid Sequences MSQDSRRAGSLSRDVAQADDRSSDNDRAFASNRNPARRPPQRPRPQSWHPYGPVEPPLESMSSRSIGVHAILNHPQATADLTALGREPLSLPGPSSSPRPQGTSPTIRSGYASASQPLSPRSHSRPLMNPASPSARFVGGSGRASGQSSVAQSPLVPHEPLMGPRLPVTSSPLPIETGLRPIAPLAVTQPPTLTSLHSTTSLHSRRTSAGPGPLTNPNSQETSPSTPHSTFSPFHHASPAVASVSLAQSNASYPTAPPYMTMDPLTRPIPATKGPRRQPEAPTRAGTPQGSPLPVGMIPCVLDMRSGSSSQAEKRKANSDASRRFRNRKRNEMQLEQRLTAQQDEIQRNVETVRRQSEELRSLVQQRDHYRSERDFYRDHLGRTMSLSALPPRPSSPRSAQPTLLPASEPGTTMSWSGADAARSASGTQPTSAGPAPQGRMIDSVQSQPAWPASPPYSSTPIAPAGRAVAGTPSGSPSAAGGPLPPLQGSWSRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.36
4 0.31
5 0.25
6 0.23
7 0.21
8 0.23
9 0.28
10 0.31
11 0.27
12 0.28
13 0.28
14 0.29
15 0.31
16 0.34
17 0.35
18 0.39
19 0.45
20 0.51
21 0.52
22 0.56
23 0.65
24 0.68
25 0.73
26 0.75
27 0.79
28 0.81
29 0.88
30 0.9
31 0.88
32 0.88
33 0.88
34 0.85
35 0.83
36 0.76
37 0.73
38 0.66
39 0.61
40 0.57
41 0.49
42 0.41
43 0.33
44 0.31
45 0.27
46 0.24
47 0.22
48 0.19
49 0.18
50 0.18
51 0.16
52 0.15
53 0.15
54 0.16
55 0.17
56 0.15
57 0.18
58 0.21
59 0.23
60 0.23
61 0.21
62 0.2
63 0.17
64 0.17
65 0.14
66 0.1
67 0.1
68 0.1
69 0.1
70 0.11
71 0.11
72 0.08
73 0.08
74 0.09
75 0.1
76 0.12
77 0.12
78 0.12
79 0.13
80 0.15
81 0.17
82 0.22
83 0.24
84 0.29
85 0.3
86 0.34
87 0.35
88 0.4
89 0.47
90 0.5
91 0.48
92 0.48
93 0.48
94 0.43
95 0.43
96 0.36
97 0.31
98 0.27
99 0.25
100 0.2
101 0.2
102 0.21
103 0.22
104 0.24
105 0.24
106 0.23
107 0.28
108 0.32
109 0.39
110 0.42
111 0.45
112 0.49
113 0.54
114 0.58
115 0.54
116 0.48
117 0.43
118 0.45
119 0.4
120 0.34
121 0.29
122 0.22
123 0.2
124 0.19
125 0.21
126 0.19
127 0.19
128 0.19
129 0.18
130 0.18
131 0.18
132 0.18
133 0.14
134 0.12
135 0.13
136 0.12
137 0.12
138 0.11
139 0.1
140 0.12
141 0.14
142 0.15
143 0.13
144 0.12
145 0.15
146 0.16
147 0.17
148 0.19
149 0.16
150 0.14
151 0.15
152 0.16
153 0.14
154 0.13
155 0.19
156 0.18
157 0.18
158 0.19
159 0.19
160 0.19
161 0.19
162 0.2
163 0.14
164 0.15
165 0.14
166 0.13
167 0.12
168 0.11
169 0.12
170 0.09
171 0.09
172 0.09
173 0.13
174 0.14
175 0.14
176 0.14
177 0.14
178 0.16
179 0.16
180 0.14
181 0.12
182 0.12
183 0.13
184 0.15
185 0.14
186 0.14
187 0.23
188 0.25
189 0.25
190 0.24
191 0.25
192 0.26
193 0.28
194 0.3
195 0.23
196 0.26
197 0.25
198 0.25
199 0.26
200 0.29
201 0.3
202 0.27
203 0.26
204 0.22
205 0.23
206 0.22
207 0.21
208 0.19
209 0.22
210 0.22
211 0.22
212 0.24
213 0.22
214 0.23
215 0.23
216 0.23
217 0.2
218 0.21
219 0.28
220 0.26
221 0.26
222 0.27
223 0.25
224 0.22
225 0.21
226 0.19
227 0.1
228 0.09
229 0.08
230 0.07
231 0.07
232 0.07
233 0.06
234 0.05
235 0.05
236 0.05
237 0.07
238 0.06
239 0.06
240 0.06
241 0.09
242 0.09
243 0.09
244 0.09
245 0.12
246 0.13
247 0.14
248 0.15
249 0.13
250 0.13
251 0.16
252 0.16
253 0.13
254 0.13
255 0.12
256 0.14
257 0.18
258 0.26
259 0.32
260 0.41
261 0.47
262 0.54
263 0.59
264 0.61
265 0.64
266 0.65
267 0.62
268 0.57
269 0.52
270 0.47
271 0.43
272 0.4
273 0.33
274 0.24
275 0.23
276 0.2
277 0.19
278 0.17
279 0.15
280 0.14
281 0.13
282 0.13
283 0.08
284 0.07
285 0.07
286 0.07
287 0.07
288 0.06
289 0.05
290 0.05
291 0.08
292 0.1
293 0.1
294 0.1
295 0.12
296 0.15
297 0.2
298 0.27
299 0.29
300 0.3
301 0.33
302 0.39
303 0.39
304 0.44
305 0.47
306 0.5
307 0.55
308 0.59
309 0.66
310 0.67
311 0.74
312 0.75
313 0.78
314 0.77
315 0.78
316 0.78
317 0.78
318 0.79
319 0.79
320 0.79
321 0.77
322 0.72
323 0.61
324 0.56
325 0.47
326 0.41
327 0.32
328 0.24
329 0.18
330 0.22
331 0.24
332 0.24
333 0.25
334 0.24
335 0.23
336 0.24
337 0.24
338 0.2
339 0.23
340 0.27
341 0.26
342 0.28
343 0.32
344 0.37
345 0.38
346 0.36
347 0.34
348 0.32
349 0.35
350 0.37
351 0.37
352 0.37
353 0.37
354 0.42
355 0.43
356 0.44
357 0.45
358 0.45
359 0.46
360 0.45
361 0.44
362 0.39
363 0.39
364 0.46
365 0.42
366 0.4
367 0.39
368 0.35
369 0.32
370 0.33
371 0.3
372 0.21
373 0.19
374 0.19
375 0.2
376 0.24
377 0.25
378 0.24
379 0.25
380 0.31
381 0.31
382 0.36
383 0.38
384 0.42
385 0.48
386 0.51
387 0.5
388 0.47
389 0.51
390 0.46
391 0.4
392 0.31
393 0.24
394 0.22
395 0.21
396 0.18
397 0.15
398 0.14
399 0.13
400 0.13
401 0.13
402 0.11
403 0.1
404 0.12
405 0.11
406 0.1
407 0.1
408 0.11
409 0.11
410 0.12
411 0.12
412 0.13
413 0.16
414 0.17
415 0.17
416 0.17
417 0.16
418 0.19
419 0.2
420 0.17
421 0.17
422 0.21
423 0.22
424 0.24
425 0.25
426 0.22
427 0.24
428 0.24
429 0.24
430 0.22
431 0.24
432 0.23
433 0.23
434 0.22
435 0.21
436 0.22
437 0.2
438 0.18
439 0.2
440 0.2
441 0.23
442 0.26
443 0.29
444 0.33
445 0.32
446 0.32
447 0.3
448 0.35
449 0.33
450 0.3
451 0.26
452 0.22
453 0.22
454 0.21
455 0.18
456 0.13
457 0.13
458 0.13
459 0.13
460 0.14
461 0.14
462 0.14
463 0.13
464 0.12
465 0.13
466 0.13
467 0.13
468 0.11
469 0.14
470 0.16
471 0.17
472 0.16
473 0.14
474 0.17