Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V6QPY3

Protein Details
Accession A0A1V6QPY3    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
37-58LEKLERLKQKLKEQRKHMNELDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007648  ATPase_inhibitor_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0042030  F:ATPase inhibitor activity  
GO:0032780  P:negative regulation of ATP-dependent activity  
Pfam View protein in Pfam  
PF04568  IATP  
Amino Acid Sequences MGAGDIGSTKSGFMAEKDSFAKREAAHEAMYIRQIELEKLERLKQKLKEQRKHMNELDKHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.17
4 0.19
5 0.21
6 0.21
7 0.22
8 0.24
9 0.19
10 0.22
11 0.22
12 0.21
13 0.2
14 0.19
15 0.19
16 0.16
17 0.17
18 0.14
19 0.1
20 0.1
21 0.09
22 0.09
23 0.11
24 0.13
25 0.14
26 0.16
27 0.21
28 0.26
29 0.29
30 0.37
31 0.41
32 0.49
33 0.57
34 0.66
35 0.7
36 0.74
37 0.81
38 0.81
39 0.83
40 0.79
41 0.79