Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V6R2S3

Protein Details
Accession A0A1V6R2S3    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
191-215GTDVPKEKKSEKKEEKLAKRKELEWBasic
NLS Segment(s)
PositionSequence
196-211KEKKSEKKEEKLAKRK
Subcellular Location(s) nucl 16, cyto_nucl 13.5, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR019180  Oxidoreductase-like_N  
Pfam View protein in Pfam  
PF09791  Oxidored-like  
Amino Acid Sequences MSIETLESKAASSESKSATACEIISKAKEITTPAETPTIEEGEKEKDTSKSSIYSPANLLSSLLSPFSFSSTSSEPTTTISTNNDKQKETKSPTKISIETPTSDSTTQPTPKPYYTSEETPLYKTLYRTRLTKTRTKQLLRAGDRAYNDPPPPPGLGDCCGSSCDPCVRDLWKQEIGIWRERWGDWGVEDGTDVPKEKKSEKKEEKLAKRKELEW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.23
4 0.23
5 0.24
6 0.23
7 0.21
8 0.18
9 0.18
10 0.18
11 0.19
12 0.2
13 0.19
14 0.19
15 0.2
16 0.2
17 0.22
18 0.24
19 0.24
20 0.23
21 0.26
22 0.25
23 0.25
24 0.25
25 0.23
26 0.18
27 0.18
28 0.18
29 0.19
30 0.2
31 0.2
32 0.19
33 0.2
34 0.23
35 0.25
36 0.25
37 0.22
38 0.23
39 0.3
40 0.29
41 0.29
42 0.27
43 0.27
44 0.25
45 0.23
46 0.22
47 0.13
48 0.13
49 0.11
50 0.1
51 0.08
52 0.08
53 0.08
54 0.1
55 0.09
56 0.09
57 0.12
58 0.14
59 0.17
60 0.17
61 0.17
62 0.16
63 0.17
64 0.19
65 0.16
66 0.15
67 0.16
68 0.2
69 0.25
70 0.32
71 0.33
72 0.32
73 0.34
74 0.38
75 0.43
76 0.44
77 0.47
78 0.46
79 0.47
80 0.51
81 0.53
82 0.49
83 0.43
84 0.42
85 0.36
86 0.31
87 0.29
88 0.26
89 0.23
90 0.21
91 0.19
92 0.15
93 0.17
94 0.19
95 0.18
96 0.2
97 0.22
98 0.22
99 0.25
100 0.25
101 0.26
102 0.27
103 0.29
104 0.29
105 0.3
106 0.3
107 0.29
108 0.28
109 0.24
110 0.22
111 0.21
112 0.24
113 0.26
114 0.28
115 0.29
116 0.33
117 0.39
118 0.43
119 0.49
120 0.48
121 0.53
122 0.59
123 0.59
124 0.59
125 0.6
126 0.66
127 0.61
128 0.61
129 0.53
130 0.47
131 0.46
132 0.43
133 0.37
134 0.32
135 0.29
136 0.25
137 0.24
138 0.22
139 0.21
140 0.19
141 0.18
142 0.16
143 0.17
144 0.18
145 0.17
146 0.16
147 0.17
148 0.16
149 0.15
150 0.15
151 0.18
152 0.17
153 0.17
154 0.19
155 0.21
156 0.26
157 0.31
158 0.34
159 0.34
160 0.33
161 0.36
162 0.41
163 0.42
164 0.44
165 0.4
166 0.38
167 0.36
168 0.36
169 0.35
170 0.29
171 0.26
172 0.19
173 0.22
174 0.19
175 0.16
176 0.16
177 0.14
178 0.15
179 0.15
180 0.17
181 0.15
182 0.19
183 0.23
184 0.3
185 0.39
186 0.45
187 0.55
188 0.64
189 0.71
190 0.77
191 0.84
192 0.88
193 0.89
194 0.9
195 0.88