Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I4YBF2

Protein Details
Accession I4YBF2    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-23GLGGRREKQKLREDPRNRQWADBasic
NLS Segment(s)
Subcellular Location(s) mito 13.5, mito_nucl 11.833, nucl 9, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000467  G_patch_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
KEGG wse:WALSEDRAFT_32740  -  
Pfam View protein in Pfam  
PF01585  G-patch  
PROSITE View protein in PROSITE  
PS50174  G_PATCH  
Amino Acid Sequences MGLGGRREKQKLREDPRNRQWADDTNKFGFKMLASQGWNPEVGLGAAKQGNVNNIKSSYKFDTMGIGADLKKKDDWSGGLEFGNILAKLNKKNTPAATPASASPSPAPSASSTSKNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.87
4 0.88
5 0.79
6 0.71
7 0.66
8 0.64
9 0.63
10 0.59
11 0.55
12 0.48
13 0.5
14 0.47
15 0.42
16 0.34
17 0.25
18 0.22
19 0.18
20 0.19
21 0.19
22 0.2
23 0.22
24 0.22
25 0.21
26 0.17
27 0.15
28 0.11
29 0.09
30 0.08
31 0.05
32 0.06
33 0.07
34 0.07
35 0.08
36 0.08
37 0.13
38 0.15
39 0.15
40 0.15
41 0.16
42 0.17
43 0.17
44 0.21
45 0.2
46 0.19
47 0.19
48 0.18
49 0.18
50 0.17
51 0.16
52 0.13
53 0.11
54 0.09
55 0.13
56 0.13
57 0.13
58 0.13
59 0.13
60 0.14
61 0.14
62 0.15
63 0.16
64 0.18
65 0.18
66 0.17
67 0.16
68 0.15
69 0.14
70 0.14
71 0.1
72 0.08
73 0.1
74 0.13
75 0.18
76 0.23
77 0.28
78 0.28
79 0.35
80 0.37
81 0.39
82 0.4
83 0.39
84 0.37
85 0.34
86 0.33
87 0.33
88 0.3
89 0.28
90 0.26
91 0.23
92 0.23
93 0.21
94 0.22
95 0.17
96 0.23
97 0.25