Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3AW23

Protein Details
Accession G3AW23    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
489-513YFGYKLIKKTKLKDPKKVDLKSIFRHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR004841  AA-permease/SLC12A_dom  
Gene Ontology GO:0016020  C:membrane  
GO:0015171  F:amino acid transmembrane transporter activity  
KEGG cten:CANTEDRAFT_128847  -  
Pfam View protein in Pfam  
PF00324  AA_permease  
Amino Acid Sequences MSASVVSGQEKDKHQVVYATQEDVGSLKENESDAGETLSKSLTSRHLGMITLVGVFGTGLFLSSGGTLATTGPVGMLLAYILVGLVVGASQMCITECACFMPVTSGYVRHSEHFVDDALGFMMGWTDIYSSIMPSELSAAAVVVQYWTDLSPAIFITIFGVACIATNVYNVRWYGEIEFVFGILKLSLIVILIVTGLVIDLGGTGDRIGFRYWKDPGPFNAKYTTGSLGNFAAFWKTVSSVVYAYGGVQAIGLLSGEAEFPRRAIYRAAKRVFYRVFTLYLLTVFVLTLIVPSNNETIASPNGTAAASPFVVAMQGQVKVLPHYINAIVCTSAFSAANIGIIKASRTLFALAAKGQAPKLFLKVNKHGLPWVGVTFACAFIPLAYMSVSSGSKTVFSWFQSITSSNLLLNWILISVNHIGMTRAFKAQGYSRKLLPYKFKGTVFASWFSLFFSVLFLLTGGFTNFIHGQFDFGSFFGAYFIIPLSIILYFGYKLIKKTKLKDPKKVDLKSIFRDIELYPEPEYPKLKGWEYITLLWA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.35
4 0.38
5 0.36
6 0.33
7 0.29
8 0.28
9 0.26
10 0.22
11 0.21
12 0.16
13 0.14
14 0.12
15 0.14
16 0.14
17 0.15
18 0.16
19 0.16
20 0.13
21 0.15
22 0.16
23 0.14
24 0.14
25 0.14
26 0.13
27 0.12
28 0.15
29 0.18
30 0.21
31 0.24
32 0.26
33 0.26
34 0.26
35 0.27
36 0.25
37 0.2
38 0.15
39 0.12
40 0.09
41 0.07
42 0.07
43 0.06
44 0.05
45 0.04
46 0.04
47 0.04
48 0.04
49 0.05
50 0.05
51 0.06
52 0.05
53 0.05
54 0.05
55 0.05
56 0.06
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.04
63 0.04
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.02
70 0.02
71 0.02
72 0.02
73 0.02
74 0.02
75 0.02
76 0.03
77 0.03
78 0.03
79 0.04
80 0.05
81 0.06
82 0.07
83 0.07
84 0.08
85 0.1
86 0.09
87 0.09
88 0.12
89 0.13
90 0.14
91 0.15
92 0.17
93 0.18
94 0.22
95 0.23
96 0.21
97 0.23
98 0.21
99 0.21
100 0.2
101 0.18
102 0.15
103 0.14
104 0.13
105 0.11
106 0.09
107 0.08
108 0.06
109 0.06
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.06
116 0.06
117 0.06
118 0.07
119 0.07
120 0.07
121 0.06
122 0.08
123 0.07
124 0.07
125 0.07
126 0.06
127 0.06
128 0.06
129 0.06
130 0.04
131 0.04
132 0.04
133 0.04
134 0.05
135 0.04
136 0.05
137 0.05
138 0.06
139 0.06
140 0.07
141 0.06
142 0.06
143 0.07
144 0.08
145 0.08
146 0.06
147 0.07
148 0.05
149 0.06
150 0.06
151 0.05
152 0.04
153 0.05
154 0.06
155 0.07
156 0.09
157 0.09
158 0.1
159 0.1
160 0.11
161 0.12
162 0.15
163 0.14
164 0.13
165 0.13
166 0.12
167 0.11
168 0.1
169 0.09
170 0.05
171 0.05
172 0.04
173 0.04
174 0.04
175 0.04
176 0.04
177 0.03
178 0.03
179 0.03
180 0.02
181 0.02
182 0.02
183 0.02
184 0.02
185 0.02
186 0.02
187 0.02
188 0.02
189 0.02
190 0.02
191 0.03
192 0.03
193 0.04
194 0.05
195 0.06
196 0.08
197 0.09
198 0.13
199 0.16
200 0.2
201 0.23
202 0.25
203 0.29
204 0.35
205 0.35
206 0.33
207 0.33
208 0.29
209 0.28
210 0.27
211 0.24
212 0.17
213 0.16
214 0.15
215 0.13
216 0.13
217 0.11
218 0.1
219 0.08
220 0.07
221 0.07
222 0.06
223 0.06
224 0.07
225 0.07
226 0.08
227 0.08
228 0.08
229 0.08
230 0.08
231 0.07
232 0.07
233 0.07
234 0.06
235 0.05
236 0.04
237 0.04
238 0.04
239 0.03
240 0.02
241 0.02
242 0.02
243 0.03
244 0.03
245 0.05
246 0.05
247 0.05
248 0.07
249 0.08
250 0.09
251 0.13
252 0.21
253 0.28
254 0.37
255 0.39
256 0.41
257 0.41
258 0.47
259 0.44
260 0.38
261 0.33
262 0.25
263 0.24
264 0.21
265 0.21
266 0.14
267 0.13
268 0.12
269 0.08
270 0.07
271 0.05
272 0.04
273 0.04
274 0.03
275 0.03
276 0.04
277 0.04
278 0.04
279 0.05
280 0.06
281 0.06
282 0.06
283 0.06
284 0.08
285 0.09
286 0.09
287 0.08
288 0.08
289 0.09
290 0.08
291 0.08
292 0.06
293 0.07
294 0.06
295 0.06
296 0.06
297 0.05
298 0.05
299 0.05
300 0.06
301 0.06
302 0.06
303 0.06
304 0.07
305 0.07
306 0.08
307 0.1
308 0.09
309 0.07
310 0.09
311 0.1
312 0.1
313 0.1
314 0.1
315 0.09
316 0.08
317 0.09
318 0.08
319 0.08
320 0.07
321 0.06
322 0.07
323 0.07
324 0.08
325 0.07
326 0.07
327 0.06
328 0.06
329 0.07
330 0.08
331 0.09
332 0.08
333 0.09
334 0.1
335 0.1
336 0.11
337 0.12
338 0.1
339 0.12
340 0.13
341 0.14
342 0.14
343 0.14
344 0.15
345 0.15
346 0.17
347 0.2
348 0.22
349 0.28
350 0.34
351 0.42
352 0.42
353 0.42
354 0.41
355 0.37
356 0.35
357 0.3
358 0.23
359 0.16
360 0.13
361 0.13
362 0.12
363 0.12
364 0.1
365 0.08
366 0.08
367 0.06
368 0.08
369 0.06
370 0.06
371 0.06
372 0.06
373 0.06
374 0.08
375 0.08
376 0.07
377 0.08
378 0.08
379 0.09
380 0.09
381 0.12
382 0.12
383 0.14
384 0.17
385 0.16
386 0.17
387 0.18
388 0.19
389 0.19
390 0.18
391 0.17
392 0.14
393 0.14
394 0.14
395 0.12
396 0.11
397 0.08
398 0.07
399 0.06
400 0.06
401 0.08
402 0.08
403 0.09
404 0.09
405 0.09
406 0.1
407 0.12
408 0.16
409 0.15
410 0.16
411 0.16
412 0.16
413 0.19
414 0.26
415 0.32
416 0.36
417 0.37
418 0.39
419 0.46
420 0.49
421 0.52
422 0.54
423 0.53
424 0.54
425 0.56
426 0.54
427 0.51
428 0.51
429 0.52
430 0.46
431 0.41
432 0.36
433 0.31
434 0.3
435 0.26
436 0.23
437 0.17
438 0.13
439 0.11
440 0.09
441 0.08
442 0.08
443 0.07
444 0.07
445 0.07
446 0.08
447 0.06
448 0.07
449 0.07
450 0.1
451 0.12
452 0.12
453 0.14
454 0.13
455 0.15
456 0.14
457 0.16
458 0.13
459 0.12
460 0.13
461 0.11
462 0.11
463 0.1
464 0.09
465 0.08
466 0.07
467 0.08
468 0.06
469 0.06
470 0.06
471 0.06
472 0.06
473 0.07
474 0.06
475 0.07
476 0.07
477 0.09
478 0.14
479 0.15
480 0.2
481 0.27
482 0.37
483 0.43
484 0.5
485 0.6
486 0.65
487 0.73
488 0.79
489 0.81
490 0.82
491 0.85
492 0.83
493 0.81
494 0.8
495 0.79
496 0.75
497 0.75
498 0.65
499 0.55
500 0.53
501 0.44
502 0.42
503 0.37
504 0.33
505 0.26
506 0.3
507 0.32
508 0.34
509 0.36
510 0.31
511 0.35
512 0.38
513 0.38
514 0.39
515 0.4
516 0.44
517 0.46