Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3BFE3

Protein Details
Accession G3BFE3    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
140-173SVDKAKKSYHGKSKKVCSYCKKTGHSRARCFVRLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 14.5, cyto 8.5
Family & Domain DBs
KEGG cten:CANTEDRAFT_116722  -  
Pfam View protein in Pfam  
PF16588  zf-C2H2_10  
Amino Acid Sequences MSLVEVSKSIGELAKAFHEKSVELDRLKALYSSKLELLNSYVACLPGENKETISDESLLDHIKSPVCCQNCNALVWDSSSEFLLLPKRLIRVPGVESDMALTQLSNSLDHTSIKDDNEENETHHGNENENHNYNHESEISVDKAKKSYHGKSKKVCSYCKKTGHSRARCFVRLNGQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.21
3 0.21
4 0.22
5 0.22
6 0.21
7 0.25
8 0.3
9 0.29
10 0.26
11 0.28
12 0.28
13 0.27
14 0.27
15 0.25
16 0.19
17 0.19
18 0.21
19 0.22
20 0.22
21 0.24
22 0.23
23 0.22
24 0.23
25 0.22
26 0.19
27 0.18
28 0.16
29 0.14
30 0.14
31 0.13
32 0.12
33 0.12
34 0.15
35 0.14
36 0.14
37 0.15
38 0.17
39 0.18
40 0.19
41 0.16
42 0.13
43 0.14
44 0.14
45 0.13
46 0.11
47 0.11
48 0.1
49 0.12
50 0.12
51 0.14
52 0.19
53 0.2
54 0.21
55 0.21
56 0.27
57 0.26
58 0.27
59 0.26
60 0.21
61 0.19
62 0.19
63 0.19
64 0.12
65 0.1
66 0.1
67 0.08
68 0.07
69 0.08
70 0.1
71 0.09
72 0.1
73 0.11
74 0.12
75 0.12
76 0.14
77 0.14
78 0.13
79 0.14
80 0.16
81 0.17
82 0.15
83 0.15
84 0.14
85 0.13
86 0.11
87 0.09
88 0.07
89 0.04
90 0.07
91 0.07
92 0.07
93 0.07
94 0.08
95 0.09
96 0.1
97 0.11
98 0.12
99 0.14
100 0.14
101 0.15
102 0.15
103 0.16
104 0.19
105 0.18
106 0.16
107 0.18
108 0.18
109 0.17
110 0.2
111 0.19
112 0.17
113 0.21
114 0.25
115 0.27
116 0.29
117 0.29
118 0.28
119 0.29
120 0.28
121 0.27
122 0.21
123 0.16
124 0.15
125 0.18
126 0.18
127 0.21
128 0.21
129 0.21
130 0.24
131 0.24
132 0.3
133 0.35
134 0.41
135 0.48
136 0.56
137 0.64
138 0.7
139 0.79
140 0.81
141 0.81
142 0.81
143 0.81
144 0.8
145 0.81
146 0.81
147 0.79
148 0.79
149 0.83
150 0.84
151 0.84
152 0.83
153 0.83
154 0.82
155 0.8
156 0.74
157 0.69