Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I4Y9D5

Protein Details
Accession I4Y9D5    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
261-282KSNEEDRRAHKRRKSEHLLEIEBasic
NLS Segment(s)
PositionSequence
271-273KRR
Subcellular Location(s) nucl 19, cyto_nucl 14.333, mito_nucl 10.499, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015267  PPP4R2  
Gene Ontology GO:0030289  C:protein phosphatase 4 complex  
GO:0019888  F:protein phosphatase regulator activity  
KEGG wse:WALSEDRAFT_60870  -  
Pfam View protein in Pfam  
PF09184  PPP4R2  
Amino Acid Sequences MELDTRTKTEPDVGASEQNSLLLGHAREQIQTPAVVLPPKRAPVVESISEKEAYEEFSRIWDVLETDFVDEPPFTIQRIAELAVRQRGTYSTVGKYLRALGKTVTVTSGKVTLAAQMKALEDVSAPPAGDTRGHAVPLDSAEMHTPGQQNSTPPTPLFSPIPFLAERASRDVSPLTIQETQVEDLGNPNLHRPTSPTSSSNNAAAAAAAALGGQPSKTKQTGTQEHHGIVDELDAGQGKVAEEPVPLSSTTKLENTPSPEKSNEEDRRAHKRRKSEHLLEIEDQKLAKEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.32
4 0.26
5 0.24
6 0.21
7 0.16
8 0.14
9 0.13
10 0.13
11 0.14
12 0.18
13 0.19
14 0.2
15 0.21
16 0.23
17 0.21
18 0.2
19 0.18
20 0.15
21 0.17
22 0.21
23 0.2
24 0.23
25 0.26
26 0.29
27 0.29
28 0.27
29 0.26
30 0.28
31 0.34
32 0.33
33 0.33
34 0.33
35 0.34
36 0.35
37 0.33
38 0.28
39 0.22
40 0.2
41 0.18
42 0.17
43 0.14
44 0.15
45 0.16
46 0.15
47 0.15
48 0.11
49 0.11
50 0.1
51 0.12
52 0.11
53 0.12
54 0.12
55 0.12
56 0.12
57 0.1
58 0.1
59 0.11
60 0.11
61 0.1
62 0.11
63 0.11
64 0.11
65 0.13
66 0.14
67 0.13
68 0.15
69 0.18
70 0.22
71 0.23
72 0.21
73 0.2
74 0.2
75 0.21
76 0.23
77 0.22
78 0.19
79 0.24
80 0.25
81 0.24
82 0.24
83 0.26
84 0.27
85 0.24
86 0.23
87 0.18
88 0.21
89 0.21
90 0.21
91 0.18
92 0.14
93 0.14
94 0.14
95 0.15
96 0.1
97 0.11
98 0.1
99 0.13
100 0.15
101 0.15
102 0.15
103 0.14
104 0.14
105 0.14
106 0.14
107 0.09
108 0.06
109 0.06
110 0.07
111 0.07
112 0.07
113 0.06
114 0.07
115 0.07
116 0.07
117 0.07
118 0.1
119 0.1
120 0.1
121 0.1
122 0.1
123 0.1
124 0.1
125 0.1
126 0.06
127 0.06
128 0.06
129 0.07
130 0.07
131 0.09
132 0.1
133 0.09
134 0.11
135 0.11
136 0.12
137 0.14
138 0.16
139 0.15
140 0.13
141 0.15
142 0.14
143 0.15
144 0.16
145 0.13
146 0.15
147 0.14
148 0.17
149 0.15
150 0.15
151 0.14
152 0.14
153 0.15
154 0.16
155 0.17
156 0.14
157 0.15
158 0.15
159 0.15
160 0.14
161 0.13
162 0.13
163 0.13
164 0.13
165 0.14
166 0.15
167 0.15
168 0.14
169 0.14
170 0.1
171 0.1
172 0.11
173 0.11
174 0.1
175 0.12
176 0.13
177 0.13
178 0.13
179 0.15
180 0.2
181 0.23
182 0.27
183 0.27
184 0.29
185 0.33
186 0.35
187 0.32
188 0.27
189 0.22
190 0.18
191 0.16
192 0.12
193 0.07
194 0.05
195 0.04
196 0.03
197 0.03
198 0.03
199 0.03
200 0.03
201 0.04
202 0.06
203 0.11
204 0.12
205 0.14
206 0.19
207 0.29
208 0.39
209 0.44
210 0.5
211 0.49
212 0.49
213 0.48
214 0.43
215 0.34
216 0.25
217 0.18
218 0.11
219 0.08
220 0.08
221 0.07
222 0.06
223 0.06
224 0.06
225 0.06
226 0.07
227 0.08
228 0.08
229 0.08
230 0.09
231 0.1
232 0.11
233 0.11
234 0.12
235 0.13
236 0.14
237 0.17
238 0.18
239 0.19
240 0.21
241 0.26
242 0.31
243 0.37
244 0.4
245 0.42
246 0.42
247 0.44
248 0.45
249 0.51
250 0.52
251 0.5
252 0.54
253 0.56
254 0.65
255 0.7
256 0.76
257 0.71
258 0.74
259 0.77
260 0.8
261 0.83
262 0.81
263 0.81
264 0.79
265 0.79
266 0.72
267 0.69
268 0.59
269 0.51
270 0.42