Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I4YIB5

Protein Details
Accession I4YIB5    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
48-68SGLSNKLRNRSPRRTQQQPVAHydrophilic
88-115ITAENKKQSHKSQQRRSKKPTNSKKEEEHydrophilic
NLS Segment(s)
PositionSequence
93-121KKQSHKSQQRRSKKPTNSKKEEEGKDKQR
Subcellular Location(s) nucl 18.5, cyto_nucl 10, mito 7
Family & Domain DBs
KEGG wse:WALSEDRAFT_31208  -  
Amino Acid Sequences MLRTLVRGTGRGSTRPLVIGDETIDLRAFRNTPAKGFVPDRSSLQGESGLSNKLRNRSPRRTQQQPVAGQFDDADHKELLNTLGERKITAENKKQSHKSQQRRSKKPTNSKKEEEGKDKQRRAYAQYTPPTDLQTRQPKETKEPRKPKLKEIEIDRVDLSSLIFETGEADIMPTNKNFNEPATLSEEERRKQHMELVGGDYERYAKYNTPLQHAISAQRMYTLSQRDELVNNIKKFTKTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.31
4 0.26
5 0.24
6 0.22
7 0.19
8 0.19
9 0.17
10 0.16
11 0.16
12 0.13
13 0.13
14 0.15
15 0.14
16 0.16
17 0.23
18 0.24
19 0.26
20 0.3
21 0.32
22 0.34
23 0.36
24 0.37
25 0.34
26 0.34
27 0.35
28 0.34
29 0.33
30 0.29
31 0.26
32 0.24
33 0.2
34 0.2
35 0.19
36 0.18
37 0.17
38 0.21
39 0.23
40 0.26
41 0.32
42 0.41
43 0.49
44 0.55
45 0.64
46 0.71
47 0.76
48 0.8
49 0.8
50 0.79
51 0.78
52 0.74
53 0.69
54 0.63
55 0.54
56 0.44
57 0.38
58 0.31
59 0.25
60 0.19
61 0.18
62 0.13
63 0.13
64 0.12
65 0.13
66 0.12
67 0.11
68 0.11
69 0.1
70 0.13
71 0.13
72 0.13
73 0.14
74 0.2
75 0.23
76 0.29
77 0.36
78 0.41
79 0.47
80 0.54
81 0.58
82 0.57
83 0.63
84 0.66
85 0.68
86 0.71
87 0.76
88 0.8
89 0.84
90 0.88
91 0.87
92 0.86
93 0.86
94 0.87
95 0.87
96 0.84
97 0.79
98 0.78
99 0.78
100 0.73
101 0.7
102 0.67
103 0.67
104 0.68
105 0.67
106 0.61
107 0.56
108 0.52
109 0.5
110 0.48
111 0.44
112 0.43
113 0.45
114 0.44
115 0.43
116 0.41
117 0.38
118 0.33
119 0.29
120 0.29
121 0.34
122 0.34
123 0.37
124 0.4
125 0.4
126 0.47
127 0.56
128 0.58
129 0.59
130 0.67
131 0.7
132 0.76
133 0.77
134 0.77
135 0.77
136 0.73
137 0.68
138 0.64
139 0.67
140 0.57
141 0.56
142 0.48
143 0.37
144 0.31
145 0.25
146 0.18
147 0.08
148 0.07
149 0.05
150 0.05
151 0.04
152 0.06
153 0.06
154 0.06
155 0.05
156 0.05
157 0.06
158 0.07
159 0.09
160 0.08
161 0.1
162 0.1
163 0.12
164 0.13
165 0.13
166 0.17
167 0.16
168 0.19
169 0.22
170 0.24
171 0.23
172 0.29
173 0.34
174 0.32
175 0.34
176 0.36
177 0.33
178 0.33
179 0.37
180 0.35
181 0.33
182 0.34
183 0.34
184 0.32
185 0.3
186 0.28
187 0.23
188 0.2
189 0.16
190 0.15
191 0.13
192 0.13
193 0.17
194 0.24
195 0.27
196 0.32
197 0.35
198 0.35
199 0.38
200 0.37
201 0.37
202 0.37
203 0.35
204 0.28
205 0.27
206 0.26
207 0.23
208 0.28
209 0.3
210 0.26
211 0.27
212 0.29
213 0.29
214 0.3
215 0.33
216 0.37
217 0.4
218 0.39
219 0.41
220 0.43