Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I4YC06

Protein Details
Accession I4YC06    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
12-31AKEWPFTKLRPKLQFKNLVQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR037653  Cbp6  
IPR046827  UQCC2/CBP6  
Gene Ontology GO:0061671  C:Cbp3p-Cbp6 complex  
GO:0043022  F:ribosome binding  
GO:0034551  P:mitochondrial respiratory chain complex III assembly  
KEGG wse:WALSEDRAFT_69061  -  
Pfam View protein in Pfam  
PF20180  UQCC2_CBP6  
Amino Acid Sequences MASQKSKLLWIAKEWPFTKLRPKLQFKNLVQNIHDKSHEHEQIAGKSVLALEALLNNKHYNKYPLSAKMLKPASAPNHYDKVLDAVDGKPIHKSFLQRFLRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.46
3 0.43
4 0.44
5 0.49
6 0.48
7 0.53
8 0.55
9 0.64
10 0.68
11 0.74
12 0.81
13 0.74
14 0.76
15 0.72
16 0.66
17 0.58
18 0.58
19 0.52
20 0.44
21 0.42
22 0.31
23 0.3
24 0.35
25 0.36
26 0.28
27 0.29
28 0.29
29 0.29
30 0.31
31 0.27
32 0.18
33 0.16
34 0.15
35 0.11
36 0.08
37 0.07
38 0.03
39 0.05
40 0.06
41 0.07
42 0.08
43 0.09
44 0.1
45 0.12
46 0.14
47 0.15
48 0.16
49 0.2
50 0.24
51 0.27
52 0.34
53 0.38
54 0.37
55 0.42
56 0.42
57 0.39
58 0.35
59 0.37
60 0.35
61 0.35
62 0.38
63 0.34
64 0.37
65 0.36
66 0.35
67 0.3
68 0.28
69 0.23
70 0.2
71 0.17
72 0.13
73 0.19
74 0.2
75 0.2
76 0.22
77 0.22
78 0.24
79 0.26
80 0.33
81 0.33
82 0.43