Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I4YAR9

Protein Details
Accession I4YAR9   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
13-51NAYQTCGKATPKKRKKATKRKAKGRKKRKSLPCPDPEFTHydrophilic
NLS Segment(s)
PositionSequence
22-41TPKKRKKATKRKAKGRKKRK
Subcellular Location(s) mito 12, nucl 11, cyto_nucl 10.5, cyto 4
Family & Domain DBs
KEGG wse:WALSEDRAFT_32820  -  
Amino Acid Sequences MRQLLYHFVGGLNAYQTCGKATPKKRKKATKRKAKGRKKRKSLPCPDPEFTVYQDDDYRAIIPQKDQKVLNEVTNIQIPHEVVIKVDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.12
5 0.14
6 0.18
7 0.25
8 0.35
9 0.45
10 0.55
11 0.64
12 0.73
13 0.82
14 0.88
15 0.9
16 0.91
17 0.91
18 0.92
19 0.93
20 0.94
21 0.94
22 0.94
23 0.94
24 0.94
25 0.92
26 0.92
27 0.92
28 0.91
29 0.9
30 0.89
31 0.87
32 0.83
33 0.74
34 0.67
35 0.57
36 0.48
37 0.39
38 0.33
39 0.24
40 0.18
41 0.18
42 0.16
43 0.14
44 0.14
45 0.12
46 0.1
47 0.13
48 0.12
49 0.15
50 0.22
51 0.26
52 0.3
53 0.31
54 0.31
55 0.35
56 0.37
57 0.35
58 0.31
59 0.28
60 0.27
61 0.29
62 0.28
63 0.22
64 0.22
65 0.19
66 0.17
67 0.19
68 0.17