Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I4YJW2

Protein Details
Accession I4YJW2   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
117-136STPKRPRRLSPPGQPRHRKVBasic
NLS Segment(s)
PositionSequence
119-149PKRPRRLSPPGQPRHRKVSDFFKKIDEKGAK
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
KEGG wse:WALSEDRAFT_26932  -  
Amino Acid Sequences MNPNRLLYRCRKTDLESCRYFIWVDDFEKAADNQLNNENYTLRTRRRHILDACKRRNDANKLSRWSTKLVDDVLAEFDKHDDEITNFSDDDDFIECSRQPNKRLYDVDSDNKEELPSTPKRPRRLSPPGQPRHRKVSDFFKKIDEKGAKRERSDTNAQLDTNELINYVKSTERSHAGLAQELEEAKGEIRKLKKEARVYNDIIGKLYKLIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.64
3 0.58
4 0.55
5 0.51
6 0.48
7 0.42
8 0.35
9 0.31
10 0.25
11 0.23
12 0.23
13 0.22
14 0.21
15 0.23
16 0.22
17 0.21
18 0.2
19 0.18
20 0.19
21 0.25
22 0.26
23 0.25
24 0.26
25 0.23
26 0.21
27 0.28
28 0.31
29 0.31
30 0.37
31 0.41
32 0.48
33 0.53
34 0.59
35 0.61
36 0.66
37 0.7
38 0.73
39 0.77
40 0.75
41 0.71
42 0.68
43 0.69
44 0.66
45 0.65
46 0.63
47 0.63
48 0.62
49 0.65
50 0.63
51 0.57
52 0.52
53 0.44
54 0.37
55 0.31
56 0.26
57 0.23
58 0.19
59 0.18
60 0.17
61 0.15
62 0.13
63 0.1
64 0.1
65 0.09
66 0.08
67 0.08
68 0.06
69 0.06
70 0.09
71 0.1
72 0.11
73 0.11
74 0.11
75 0.11
76 0.1
77 0.1
78 0.09
79 0.08
80 0.07
81 0.09
82 0.09
83 0.11
84 0.17
85 0.19
86 0.21
87 0.27
88 0.3
89 0.35
90 0.37
91 0.37
92 0.39
93 0.39
94 0.42
95 0.38
96 0.37
97 0.32
98 0.3
99 0.26
100 0.2
101 0.16
102 0.16
103 0.17
104 0.22
105 0.31
106 0.36
107 0.44
108 0.49
109 0.52
110 0.56
111 0.63
112 0.65
113 0.66
114 0.72
115 0.74
116 0.79
117 0.83
118 0.78
119 0.77
120 0.73
121 0.65
122 0.59
123 0.6
124 0.6
125 0.56
126 0.53
127 0.51
128 0.5
129 0.48
130 0.53
131 0.49
132 0.42
133 0.48
134 0.56
135 0.54
136 0.52
137 0.57
138 0.52
139 0.51
140 0.55
141 0.5
142 0.46
143 0.45
144 0.43
145 0.37
146 0.34
147 0.29
148 0.22
149 0.17
150 0.11
151 0.09
152 0.09
153 0.09
154 0.09
155 0.1
156 0.11
157 0.14
158 0.17
159 0.2
160 0.22
161 0.23
162 0.25
163 0.25
164 0.26
165 0.25
166 0.22
167 0.2
168 0.19
169 0.17
170 0.14
171 0.13
172 0.1
173 0.12
174 0.12
175 0.18
176 0.23
177 0.29
178 0.36
179 0.44
180 0.51
181 0.58
182 0.66
183 0.67
184 0.7
185 0.67
186 0.67
187 0.65
188 0.57
189 0.49
190 0.41
191 0.33