Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I4YAE8

Protein Details
Accession I4YAE8    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
50-78RDERIDRTKRNQEKAKVRNQKKQEAWSNLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 5, pero 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
KEGG wse:WALSEDRAFT_69383  -  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MHPHLYTDAKQAACGDIIRQLYECREEGGWMFRILGGCQDIDKQLGKCLRDERIDRTKRNQEKAKVRNQKKQEAWSNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.16
3 0.15
4 0.16
5 0.15
6 0.16
7 0.16
8 0.16
9 0.19
10 0.18
11 0.15
12 0.14
13 0.14
14 0.14
15 0.16
16 0.16
17 0.13
18 0.13
19 0.12
20 0.12
21 0.12
22 0.12
23 0.09
24 0.07
25 0.07
26 0.08
27 0.07
28 0.08
29 0.11
30 0.1
31 0.14
32 0.17
33 0.17
34 0.2
35 0.23
36 0.26
37 0.3
38 0.33
39 0.36
40 0.43
41 0.51
42 0.52
43 0.58
44 0.64
45 0.66
46 0.73
47 0.74
48 0.73
49 0.77
50 0.81
51 0.83
52 0.84
53 0.84
54 0.85
55 0.84
56 0.85
57 0.82
58 0.83