FuNGI

A0A1V6RBN5

Protein Details

Accession

A0A1V6RBN5

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
428-467	GEEGKGRKLPKFRREWVRAFFEGHERRKAMWKRLNLKSRA	Basic

NLS Segment(s)

Position	Sequence
432-460	KGRKLPKFRREWVRAFFEGHERRKAMWKR

Subcellular Location(s)

cyto 9, extr 6, cyto_pero 6, E.R. 4

Family & Domain DBs

InterPro	View protein in InterPro IPR036188 FAD/NAD-bd_sf IPR000960 Flavin_mOase IPR020946 Flavin_mOase-like
Gene Ontology	GO:0050660 F:flavin adenine dinucleotide binding GO:0004499 F:N,N-dimethylaniline monooxygenase activity GO:0050661 F:NADP binding
Pfam	View protein in Pfam PF00743 FMO-like

Amino Acid Sequences

MMVPVKRVAVIGAGPAGAIAIDALAQEKTFDIIRVFERREGPGGCWIGDSSQPPTLRDFASLATRTADPPLSIPESLPAQTPKSDQPRFTESSVYPYLETNVDFLPMEFAQEPFPEERSELSISHHGPKTPFRKWDVVRKYVRSLVERRGYGDWVSYNTTVERVEKVGTEWKVTLRKDGEKSDYWCVEWFDAVVVASGHFWVPYIPPIEGLEAFEKTRPGSVLHSKHFRGREAFVGKRVVVVGASVSAADIAFDLVETAKEPVHAITIGHAANGYFGDEAFNHPKIQKHPSIERVSNRTVHLTNGNCITDVDHIVFGTGYSWTLPFLPAVPVRNNRVPDLYQHVVWQKDPTLLFVGAVAAGLTFKVFEWQAVLAARLLAGRATLPSADVMQKWEADRIEVRGDGVKFTLLFPDFEDYFETVRLLAGEGEEGKGRKLPKFRREWVRAFFEGHERRKAMWKRLNLKSRAALMNTETIHKEVARL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.1
2	0.1
3	0.09
4	0.06
5	0.06
6	0.04
7	0.03
8	0.03
9	0.03
10	0.05
11	0.05
12	0.05
13	0.06
14	0.06
15	0.08
16	0.09
17	0.11
18	0.1
19	0.14
20	0.19
21	0.26
22	0.29
23	0.33
24	0.36
25	0.37
26	0.42
27	0.4
28	0.37
29	0.38
30	0.37
31	0.32
32	0.29
33	0.26
34	0.23
35	0.24
36	0.24
37	0.2
38	0.24
39	0.25
40	0.25
41	0.28
42	0.3
43	0.27
44	0.27
45	0.24
46	0.21
47	0.27
48	0.27
49	0.25
50	0.24
51	0.24
52	0.23
53	0.25
54	0.24
55	0.16
56	0.16
57	0.2
58	0.21
59	0.2
60	0.2
61	0.19
62	0.21
63	0.21
64	0.23
65	0.21
66	0.2
67	0.21
68	0.25
69	0.3
70	0.38
71	0.42
72	0.42
73	0.45
74	0.5
75	0.51
76	0.5
77	0.48
78	0.38
79	0.4
80	0.4
81	0.35
82	0.29
83	0.26
84	0.26
85	0.21
86	0.2
87	0.15
88	0.12
89	0.12
90	0.12
91	0.11
92	0.13
93	0.11
94	0.13
95	0.12
96	0.12
97	0.13
98	0.13
99	0.16
100	0.13
101	0.15
102	0.13
103	0.13
104	0.14
105	0.16
106	0.18
107	0.16
108	0.18
109	0.23
110	0.24
111	0.31
112	0.32
113	0.3
114	0.3
115	0.39
116	0.43
117	0.43
118	0.47
119	0.45
120	0.52
121	0.54
122	0.63
123	0.62
124	0.64
125	0.65
126	0.63
127	0.63
128	0.59
129	0.59
130	0.54
131	0.51
132	0.5
133	0.49
134	0.46
135	0.44
136	0.4
137	0.38
138	0.32
139	0.29
140	0.22
141	0.17
142	0.2
143	0.17
144	0.16
145	0.15
146	0.16
147	0.14
148	0.14
149	0.13
150	0.11
151	0.12
152	0.11
153	0.13
154	0.18
155	0.18
156	0.19
157	0.19
158	0.22
159	0.28
160	0.28
161	0.32
162	0.29
163	0.35
164	0.37
165	0.4
166	0.41
167	0.39
168	0.42
169	0.43
170	0.39
171	0.34
172	0.31
173	0.28
174	0.23
175	0.18
176	0.15
177	0.09
178	0.08
179	0.07
180	0.06
181	0.05
182	0.04
183	0.04
184	0.05
185	0.04
186	0.04
187	0.04
188	0.04
189	0.05
190	0.07
191	0.08
192	0.08
193	0.09
194	0.1
195	0.11
196	0.11
197	0.12
198	0.11
199	0.1
200	0.11
201	0.11
202	0.11
203	0.1
204	0.11
205	0.1
206	0.1
207	0.13
208	0.21
209	0.26
210	0.3
211	0.35
212	0.36
213	0.4
214	0.41
215	0.39
216	0.33
217	0.29
218	0.32
219	0.33
220	0.33
221	0.31
222	0.31
223	0.28
224	0.26
225	0.24
226	0.17
227	0.1
228	0.09
229	0.06
230	0.04
231	0.04
232	0.03
233	0.03
234	0.03
235	0.03
236	0.03
237	0.03
238	0.02
239	0.02
240	0.02
241	0.03
242	0.03
243	0.03
244	0.03
245	0.04
246	0.04
247	0.05
248	0.05
249	0.05
250	0.06
251	0.06
252	0.06
253	0.06
254	0.09
255	0.09
256	0.09
257	0.09
258	0.07
259	0.08
260	0.08
261	0.07
262	0.04
263	0.04
264	0.05
265	0.05
266	0.09
267	0.12
268	0.14
269	0.14
270	0.16
271	0.2
272	0.23
273	0.29
274	0.31
275	0.33
276	0.38
277	0.45
278	0.5
279	0.52
280	0.53
281	0.53
282	0.5
283	0.48
284	0.43
285	0.38
286	0.32
287	0.29
288	0.3
289	0.25
290	0.24
291	0.24
292	0.23
293	0.2
294	0.19
295	0.18
296	0.14
297	0.14
298	0.12
299	0.09
300	0.09
301	0.09
302	0.09
303	0.07
304	0.06
305	0.05
306	0.04
307	0.05
308	0.05
309	0.05
310	0.06
311	0.06
312	0.06
313	0.07
314	0.1
315	0.12
316	0.16
317	0.21
318	0.25
319	0.31
320	0.36
321	0.37
322	0.35
323	0.36
324	0.33
325	0.3
326	0.34
327	0.31
328	0.26
329	0.28
330	0.31
331	0.29
332	0.29
333	0.28
334	0.21
335	0.23
336	0.23
337	0.21
338	0.2
339	0.19
340	0.18
341	0.15
342	0.14
343	0.09
344	0.09
345	0.07
346	0.04
347	0.03
348	0.03
349	0.03
350	0.03
351	0.03
352	0.06
353	0.06
354	0.06
355	0.08
356	0.08
357	0.11
358	0.11
359	0.12
360	0.1
361	0.09
362	0.1
363	0.08
364	0.08
365	0.06
366	0.05
367	0.05
368	0.06
369	0.07
370	0.06
371	0.07
372	0.07
373	0.1
374	0.12
375	0.12
376	0.14
377	0.15
378	0.17
379	0.18
380	0.21
381	0.19
382	0.2
383	0.22
384	0.21
385	0.23
386	0.21
387	0.21
388	0.23
389	0.23
390	0.21
391	0.19
392	0.18
393	0.15
394	0.15
395	0.2
396	0.15
397	0.15
398	0.16
399	0.2
400	0.19
401	0.19
402	0.22
403	0.18
404	0.18
405	0.18
406	0.17
407	0.12
408	0.12
409	0.11
410	0.09
411	0.08
412	0.07
413	0.08
414	0.09
415	0.1
416	0.13
417	0.13
418	0.14
419	0.17
420	0.2
421	0.24
422	0.34
423	0.43
424	0.5
425	0.6
426	0.68
427	0.76
428	0.81
429	0.84
430	0.82
431	0.8
432	0.72
433	0.65
434	0.59
435	0.58
436	0.59
437	0.56
438	0.56
439	0.5
440	0.5
441	0.57
442	0.62
443	0.62
444	0.61
445	0.66
446	0.68
447	0.77
448	0.84
449	0.78
450	0.77
451	0.73
452	0.72
453	0.68
454	0.6
455	0.53
456	0.46
457	0.48
458	0.42
459	0.39
460	0.33
461	0.29
462	0.29

A0A1V6RBN5

3D AlphaFold-predicted Structure Viewer