Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V6RXG9

Protein Details
Accession A0A1V6RXG9    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
122-173KEPEEKKQPEEKKQPEEKKEPEEKKEPKEKKEPEEKKEPKEKKQPEEEKEESAcidic
NLS Segment(s)
PositionSequence
126-166EKKQPEEKKQPEEKKEPEEKKEPKEKKEPEEKKEPKEKKQP
Subcellular Location(s) mito 16.5, cyto_mito 10.5, nucl 9
Family & Domain DBs
Amino Acid Sequences MVFARRSIFRAANAAQSFRAAPVVRQSAQLLGRRFKSTGGSYEPGHTSSDLPWLAVSAAVTVPMVFYLWPSSSEGHHDTHGHENNDEHAEKSEAEEAEEDKPAEDSSEAVPKKEERSDTEEKEPEEKKQPEEKKQPEEKKEPEEKKEPKEKKEPEEKKEPKEKKQPEEEKEESKDDDPKEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.31
3 0.3
4 0.29
5 0.22
6 0.26
7 0.17
8 0.17
9 0.23
10 0.29
11 0.28
12 0.29
13 0.3
14 0.3
15 0.34
16 0.39
17 0.36
18 0.36
19 0.38
20 0.39
21 0.39
22 0.35
23 0.35
24 0.32
25 0.32
26 0.33
27 0.32
28 0.3
29 0.33
30 0.33
31 0.28
32 0.27
33 0.23
34 0.17
35 0.15
36 0.2
37 0.16
38 0.15
39 0.13
40 0.13
41 0.12
42 0.11
43 0.1
44 0.05
45 0.05
46 0.05
47 0.05
48 0.04
49 0.04
50 0.04
51 0.04
52 0.03
53 0.04
54 0.05
55 0.06
56 0.07
57 0.09
58 0.09
59 0.1
60 0.14
61 0.16
62 0.16
63 0.17
64 0.17
65 0.18
66 0.25
67 0.29
68 0.25
69 0.23
70 0.22
71 0.23
72 0.25
73 0.23
74 0.16
75 0.12
76 0.12
77 0.12
78 0.12
79 0.13
80 0.1
81 0.1
82 0.1
83 0.11
84 0.11
85 0.12
86 0.11
87 0.08
88 0.08
89 0.08
90 0.08
91 0.06
92 0.06
93 0.07
94 0.15
95 0.15
96 0.15
97 0.16
98 0.17
99 0.21
100 0.23
101 0.24
102 0.21
103 0.29
104 0.36
105 0.39
106 0.44
107 0.44
108 0.42
109 0.46
110 0.43
111 0.39
112 0.42
113 0.4
114 0.39
115 0.46
116 0.52
117 0.56
118 0.65
119 0.69
120 0.69
121 0.77
122 0.81
123 0.8
124 0.81
125 0.77
126 0.76
127 0.79
128 0.75
129 0.72
130 0.73
131 0.73
132 0.73
133 0.77
134 0.76
135 0.73
136 0.77
137 0.78
138 0.77
139 0.81
140 0.81
141 0.77
142 0.81
143 0.81
144 0.79
145 0.82
146 0.81
147 0.8
148 0.82
149 0.84
150 0.82
151 0.85
152 0.86
153 0.82
154 0.83
155 0.79
156 0.76
157 0.71
158 0.66
159 0.58
160 0.51
161 0.52
162 0.44