Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V6RVP0

Protein Details
Accession A0A1V6RVP0   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
4-29RKRTDDSASKTPKKPKKNLTNSDLGHHydrophilic
NLS Segment(s)
PositionSequence
16-19KKPK
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MAPRKRTDDSASKTPKKPKKNLTNSDLGHADKPEYKEQCKRAQGKVRNGRPAWKHGENDSKPLGTTVSEEDAATAPLAIETRFNSANEWDQPRTVSSCPTRACIWQRSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.79
3 0.79
4 0.81
5 0.81
6 0.82
7 0.85
8 0.87
9 0.83
10 0.83
11 0.74
12 0.69
13 0.61
14 0.51
15 0.42
16 0.33
17 0.29
18 0.23
19 0.26
20 0.29
21 0.3
22 0.34
23 0.4
24 0.44
25 0.51
26 0.55
27 0.57
28 0.58
29 0.64
30 0.67
31 0.7
32 0.75
33 0.73
34 0.73
35 0.69
36 0.67
37 0.6
38 0.57
39 0.54
40 0.48
41 0.43
42 0.39
43 0.48
44 0.42
45 0.43
46 0.39
47 0.32
48 0.27
49 0.26
50 0.22
51 0.12
52 0.12
53 0.1
54 0.1
55 0.1
56 0.1
57 0.11
58 0.11
59 0.11
60 0.09
61 0.07
62 0.05
63 0.05
64 0.06
65 0.05
66 0.06
67 0.07
68 0.1
69 0.12
70 0.12
71 0.14
72 0.16
73 0.21
74 0.26
75 0.31
76 0.29
77 0.29
78 0.29
79 0.3
80 0.32
81 0.27
82 0.29
83 0.29
84 0.35
85 0.36
86 0.38
87 0.38
88 0.42
89 0.49