Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V6RTK6

Protein Details
Accession A0A1V6RTK6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
28-47LIKMRSDRKKKEKELENSFQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7, plas 6, cyto 4, extr 4, mito_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGLVKLLLKAILIPIVVLLVIAVAIFLLIKMRSDRKKKEKELENSFQPPPIQQWVPYTPVQQPAPAYVKTPGAMEQGVGGLMIVFADREVLQTVSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.05
5 0.04
6 0.02
7 0.02
8 0.02
9 0.02
10 0.02
11 0.02
12 0.02
13 0.02
14 0.03
15 0.04
16 0.05
17 0.08
18 0.16
19 0.24
20 0.33
21 0.43
22 0.52
23 0.62
24 0.69
25 0.76
26 0.79
27 0.8
28 0.8
29 0.77
30 0.72
31 0.66
32 0.59
33 0.51
34 0.41
35 0.32
36 0.25
37 0.23
38 0.18
39 0.14
40 0.18
41 0.19
42 0.22
43 0.23
44 0.23
45 0.21
46 0.27
47 0.26
48 0.23
49 0.22
50 0.23
51 0.25
52 0.23
53 0.23
54 0.19
55 0.2
56 0.19
57 0.19
58 0.16
59 0.15
60 0.14
61 0.13
62 0.11
63 0.1
64 0.09
65 0.08
66 0.06
67 0.04
68 0.04
69 0.03
70 0.03
71 0.03
72 0.03
73 0.04
74 0.05
75 0.06
76 0.08