Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V6RDT1

Protein Details
Accession A0A1V6RDT1    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MKPRREPILQNKSKNQKRKLPNGFLFEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25
Family & Domain DBs
Amino Acid Sequences MKPRREPILQNKSKNQKRKLPNGFLFEKQVSSHKTNIEALLGQTIDEEPRQGLVSVNCQILDDKSTSCVRMPAC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.81
3 0.8
4 0.8
5 0.83
6 0.84
7 0.83
8 0.8
9 0.77
10 0.73
11 0.65
12 0.6
13 0.5
14 0.41
15 0.31
16 0.29
17 0.27
18 0.26
19 0.27
20 0.23
21 0.24
22 0.24
23 0.24
24 0.2
25 0.15
26 0.12
27 0.11
28 0.1
29 0.07
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.05
36 0.06
37 0.07
38 0.07
39 0.09
40 0.1
41 0.15
42 0.17
43 0.18
44 0.17
45 0.17
46 0.18
47 0.17
48 0.18
49 0.15
50 0.12
51 0.16
52 0.18
53 0.19
54 0.19