Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V6RWP5

Protein Details
Accession A0A1V6RWP5   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
84-103AEAKEHKKLKQEQDQRQQEEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 17, cyto_nucl 14.5, nucl 8
Family & Domain DBs
Amino Acid Sequences MLSDVVNVTGPKIMAIALMDSLEQLLDRPVDDRDYALTKRPKLVGEVLVMPGVSFAALQNGNPTDQGDVLVTHHYEGSWKKEDAEAKEHKKLKQEQDQRQQEEATKEATSLPPPPPPPPASASADAAVAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.08
4 0.07
5 0.07
6 0.07
7 0.06
8 0.06
9 0.06
10 0.05
11 0.04
12 0.05
13 0.05
14 0.06
15 0.07
16 0.08
17 0.11
18 0.11
19 0.11
20 0.13
21 0.17
22 0.18
23 0.25
24 0.3
25 0.3
26 0.33
27 0.35
28 0.33
29 0.31
30 0.34
31 0.28
32 0.24
33 0.24
34 0.2
35 0.18
36 0.17
37 0.14
38 0.1
39 0.07
40 0.05
41 0.03
42 0.03
43 0.05
44 0.05
45 0.06
46 0.08
47 0.08
48 0.09
49 0.09
50 0.09
51 0.07
52 0.07
53 0.07
54 0.06
55 0.06
56 0.06
57 0.07
58 0.07
59 0.07
60 0.06
61 0.06
62 0.08
63 0.1
64 0.15
65 0.18
66 0.18
67 0.18
68 0.22
69 0.27
70 0.28
71 0.34
72 0.37
73 0.39
74 0.48
75 0.52
76 0.51
77 0.55
78 0.59
79 0.61
80 0.62
81 0.67
82 0.69
83 0.75
84 0.82
85 0.79
86 0.73
87 0.65
88 0.59
89 0.52
90 0.43
91 0.35
92 0.26
93 0.21
94 0.21
95 0.21
96 0.19
97 0.2
98 0.21
99 0.25
100 0.28
101 0.31
102 0.35
103 0.36
104 0.38
105 0.37
106 0.4
107 0.39
108 0.4
109 0.4
110 0.33