Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V6RS38

Protein Details
Accession A0A1V6RS38    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-28AKQHIPIVKKRTNRFNRHQSDRFMRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 8, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAAKQHIPIVKKRTNRFNRHQSDRFMRVGASWRKPKGIDNCVRRRFKGQMAMPSIGYGSNKKTRHMMPSGHKAFLVHNTKDVELLLMHNRTFAAEIGHAVSSRKRVEIIEKAKALGVKVTNPKGRVTTEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.72
3 0.78
4 0.81
5 0.82
6 0.85
7 0.86
8 0.84
9 0.81
10 0.79
11 0.75
12 0.66
13 0.56
14 0.46
15 0.38
16 0.42
17 0.41
18 0.41
19 0.44
20 0.44
21 0.46
22 0.47
23 0.52
24 0.52
25 0.54
26 0.54
27 0.56
28 0.65
29 0.71
30 0.74
31 0.69
32 0.65
33 0.59
34 0.56
35 0.55
36 0.48
37 0.47
38 0.48
39 0.47
40 0.42
41 0.37
42 0.32
43 0.23
44 0.2
45 0.13
46 0.13
47 0.19
48 0.2
49 0.21
50 0.25
51 0.26
52 0.31
53 0.33
54 0.35
55 0.34
56 0.44
57 0.45
58 0.42
59 0.4
60 0.35
61 0.32
62 0.34
63 0.34
64 0.24
65 0.25
66 0.26
67 0.26
68 0.26
69 0.25
70 0.17
71 0.1
72 0.12
73 0.13
74 0.13
75 0.13
76 0.13
77 0.13
78 0.13
79 0.13
80 0.12
81 0.09
82 0.08
83 0.09
84 0.1
85 0.11
86 0.11
87 0.11
88 0.13
89 0.16
90 0.17
91 0.17
92 0.17
93 0.18
94 0.25
95 0.34
96 0.39
97 0.42
98 0.41
99 0.41
100 0.42
101 0.42
102 0.35
103 0.3
104 0.26
105 0.25
106 0.33
107 0.4
108 0.44
109 0.45
110 0.47
111 0.46