Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4FBT7

Protein Details
Accession A0A0C4FBT7    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
98-120KQPTKESKERDPKKPYKIPKIDQBasic
125-151ALGSKPKTYERKPKKGENKWKETFRMAHydrophilic
NLS Segment(s)
PositionSequence
101-144TKESKERDPKKPYKIPKIDQSKPAALGSKPKTYERKPKKGENKW
Subcellular Location(s) nucl 17, cyto 7, mito 2
Family & Domain DBs
Amino Acid Sequences MVDTRSGKDHSANPPPTKRVLNKAQEDAILIFKAAKAAYLNAKNYDEMDLLKSYLEQVISLFKVVQKFLPWKEILANHSDGWNPYTERKHIKVLENNKQPTKESKERDPKKPYKIPKIDQSKPAALGSKPKTYERKPKKGENKWKETFRMAQVLMEVKDAIKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.62
3 0.63
4 0.64
5 0.61
6 0.59
7 0.61
8 0.63
9 0.62
10 0.63
11 0.6
12 0.52
13 0.49
14 0.41
15 0.33
16 0.24
17 0.17
18 0.13
19 0.11
20 0.12
21 0.1
22 0.1
23 0.08
24 0.1
25 0.18
26 0.23
27 0.25
28 0.27
29 0.28
30 0.28
31 0.27
32 0.27
33 0.2
34 0.16
35 0.16
36 0.13
37 0.12
38 0.12
39 0.11
40 0.09
41 0.1
42 0.09
43 0.06
44 0.06
45 0.09
46 0.09
47 0.09
48 0.09
49 0.09
50 0.11
51 0.11
52 0.12
53 0.12
54 0.17
55 0.18
56 0.22
57 0.21
58 0.2
59 0.23
60 0.24
61 0.23
62 0.21
63 0.22
64 0.17
65 0.18
66 0.18
67 0.15
68 0.13
69 0.13
70 0.11
71 0.13
72 0.15
73 0.18
74 0.23
75 0.25
76 0.3
77 0.33
78 0.39
79 0.42
80 0.49
81 0.56
82 0.59
83 0.62
84 0.58
85 0.56
86 0.51
87 0.5
88 0.5
89 0.49
90 0.45
91 0.5
92 0.59
93 0.65
94 0.72
95 0.76
96 0.75
97 0.77
98 0.8
99 0.8
100 0.8
101 0.82
102 0.78
103 0.77
104 0.79
105 0.75
106 0.73
107 0.7
108 0.62
109 0.54
110 0.5
111 0.44
112 0.35
113 0.39
114 0.36
115 0.38
116 0.37
117 0.42
118 0.49
119 0.53
120 0.64
121 0.65
122 0.71
123 0.72
124 0.8
125 0.84
126 0.87
127 0.9
128 0.89
129 0.89
130 0.87
131 0.87
132 0.81
133 0.76
134 0.72
135 0.65
136 0.62
137 0.53
138 0.45
139 0.41
140 0.4
141 0.35
142 0.3
143 0.25