Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4F9S8

Protein Details
Accession A0A0C4F9S8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
150-169FNPACPFKKAWLEKKRFPPQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, cyto 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MAHGVPKTFDITKSSNLATLASENNFQASDLARVCWMGSNEPSGKKAGSIVMAFVNKDLALRIKQSGIFLKYDYHRTEHFKPRPPQCFKCLKMGHFGKWCREPAQCAKCGSNHSTNKCPEGIGGVKSCVLCKDGLKNKTEGIKDVDHTPFNPACPFKKAWLEKKRFPPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.27
4 0.26
5 0.22
6 0.21
7 0.2
8 0.17
9 0.18
10 0.16
11 0.17
12 0.16
13 0.15
14 0.13
15 0.11
16 0.13
17 0.13
18 0.13
19 0.12
20 0.13
21 0.13
22 0.15
23 0.15
24 0.14
25 0.14
26 0.19
27 0.23
28 0.24
29 0.25
30 0.23
31 0.22
32 0.19
33 0.19
34 0.15
35 0.14
36 0.13
37 0.13
38 0.15
39 0.15
40 0.15
41 0.14
42 0.13
43 0.1
44 0.1
45 0.09
46 0.08
47 0.09
48 0.11
49 0.12
50 0.13
51 0.14
52 0.16
53 0.19
54 0.18
55 0.18
56 0.17
57 0.19
58 0.2
59 0.24
60 0.23
61 0.22
62 0.23
63 0.28
64 0.35
65 0.42
66 0.47
67 0.51
68 0.57
69 0.63
70 0.7
71 0.71
72 0.68
73 0.64
74 0.67
75 0.6
76 0.62
77 0.58
78 0.49
79 0.51
80 0.5
81 0.48
82 0.47
83 0.47
84 0.42
85 0.43
86 0.44
87 0.37
88 0.35
89 0.35
90 0.38
91 0.42
92 0.41
93 0.39
94 0.38
95 0.38
96 0.41
97 0.41
98 0.41
99 0.42
100 0.43
101 0.48
102 0.48
103 0.48
104 0.44
105 0.39
106 0.29
107 0.27
108 0.25
109 0.2
110 0.19
111 0.18
112 0.19
113 0.2
114 0.2
115 0.16
116 0.15
117 0.13
118 0.14
119 0.23
120 0.3
121 0.34
122 0.37
123 0.38
124 0.4
125 0.46
126 0.45
127 0.38
128 0.35
129 0.33
130 0.32
131 0.37
132 0.37
133 0.32
134 0.31
135 0.34
136 0.31
137 0.29
138 0.33
139 0.31
140 0.31
141 0.34
142 0.37
143 0.36
144 0.45
145 0.52
146 0.57
147 0.64
148 0.7
149 0.74