Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V6V7G3

Protein Details
Accession A0A1V6V7G3   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
39-68ITLWLRQRTPARKRKRKIRMHKERLVRRLRBasic
NLS Segment(s)
PositionSequence
46-68RTPARKRKRKIRMHKERLVRRLR
Subcellular Location(s) mito 15, nucl 6.5, cyto_nucl 6, cyto 4.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MNTSTHSKLHKQNTNPTLTSNIKHTLIQLISMLLIFVLITLWLRQRTPARKRKRKIRMHKERLVRRLRAERQFNTISLRQRPAGLYTTSSVVASAYEARVETQSAEVMPKTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.65
3 0.58
4 0.55
5 0.5
6 0.45
7 0.39
8 0.36
9 0.3
10 0.3
11 0.29
12 0.27
13 0.23
14 0.22
15 0.18
16 0.14
17 0.12
18 0.12
19 0.11
20 0.05
21 0.04
22 0.03
23 0.03
24 0.02
25 0.02
26 0.03
27 0.04
28 0.06
29 0.08
30 0.08
31 0.12
32 0.2
33 0.29
34 0.39
35 0.48
36 0.57
37 0.67
38 0.75
39 0.82
40 0.85
41 0.87
42 0.88
43 0.9
44 0.9
45 0.89
46 0.88
47 0.87
48 0.85
49 0.83
50 0.79
51 0.72
52 0.66
53 0.67
54 0.67
55 0.66
56 0.66
57 0.58
58 0.57
59 0.56
60 0.5
61 0.46
62 0.43
63 0.4
64 0.37
65 0.38
66 0.32
67 0.32
68 0.32
69 0.3
70 0.28
71 0.24
72 0.21
73 0.19
74 0.2
75 0.19
76 0.18
77 0.15
78 0.11
79 0.1
80 0.09
81 0.1
82 0.08
83 0.09
84 0.09
85 0.1
86 0.11
87 0.12
88 0.11
89 0.11
90 0.12
91 0.12
92 0.14