Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4F446

Protein Details
Accession A0A0C4F446    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
17-51EGIRLKGFSPKKQLKKKRSGSKSKMRNQQHSRQTLHydrophilic
NLS Segment(s)
PositionSequence
21-41LKGFSPKKQLKKKRSGSKSKM
Subcellular Location(s) mito 18.5, mito_nucl 12.999, nucl 6, cyto_nucl 5.333
Family & Domain DBs
Amino Acid Sequences MSIPRGLLHWWFIGRQEGIRLKGFSPKKQLKKKRSGSKSKMRNQQHSRQTLSTLPVLPAVKTLFDNIKATSDTKNTSSQNLVKVPLPWQSDEFTQLAQKLDAIYAQKKITTNGQIFAHAFILKSQRSTSGPIAPGNIKNVPQNLPANCYSETYWSTLSDSEKQLLNPQDPIEWPLLHTIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.28
4 0.3
5 0.33
6 0.36
7 0.36
8 0.31
9 0.39
10 0.44
11 0.42
12 0.48
13 0.54
14 0.6
15 0.7
16 0.8
17 0.81
18 0.86
19 0.9
20 0.91
21 0.91
22 0.92
23 0.91
24 0.91
25 0.91
26 0.89
27 0.88
28 0.86
29 0.86
30 0.83
31 0.83
32 0.82
33 0.78
34 0.74
35 0.65
36 0.59
37 0.51
38 0.45
39 0.39
40 0.3
41 0.24
42 0.23
43 0.22
44 0.19
45 0.18
46 0.16
47 0.13
48 0.13
49 0.14
50 0.12
51 0.14
52 0.15
53 0.14
54 0.15
55 0.15
56 0.16
57 0.17
58 0.17
59 0.17
60 0.18
61 0.23
62 0.22
63 0.23
64 0.26
65 0.26
66 0.28
67 0.27
68 0.26
69 0.21
70 0.21
71 0.21
72 0.23
73 0.22
74 0.18
75 0.18
76 0.18
77 0.18
78 0.19
79 0.18
80 0.13
81 0.12
82 0.13
83 0.12
84 0.1
85 0.1
86 0.07
87 0.07
88 0.08
89 0.1
90 0.1
91 0.13
92 0.13
93 0.15
94 0.15
95 0.17
96 0.2
97 0.24
98 0.24
99 0.25
100 0.25
101 0.25
102 0.25
103 0.24
104 0.21
105 0.15
106 0.13
107 0.12
108 0.16
109 0.14
110 0.15
111 0.15
112 0.17
113 0.18
114 0.23
115 0.24
116 0.25
117 0.27
118 0.27
119 0.29
120 0.29
121 0.29
122 0.29
123 0.28
124 0.24
125 0.25
126 0.27
127 0.27
128 0.29
129 0.33
130 0.3
131 0.33
132 0.33
133 0.33
134 0.31
135 0.3
136 0.26
137 0.24
138 0.25
139 0.23
140 0.22
141 0.19
142 0.2
143 0.21
144 0.24
145 0.24
146 0.26
147 0.26
148 0.26
149 0.26
150 0.32
151 0.35
152 0.33
153 0.31
154 0.3
155 0.3
156 0.29
157 0.31
158 0.28
159 0.22
160 0.21