Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3B3A2

Protein Details
Accession G3B3A2    Localization Confidence High Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
64-92STSGWRDSRKSQYKQKKNSKKKTGKALKFHydrophilic
NLS Segment(s)
PositionSequence
12-24RAKSIKRNKEFKD
27-32DKRRER
72-92RKSQYKQKKNSKKKTGKALKF
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG cten:CANTEDRAFT_105063  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRSKNVLRAKSIKRNKEFKDLDDKRRERLANKMKEELNKQDKTGSKLEDNEAVNADKKISTSGWRDSRKSQYKQKKNSKKKTGKALKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.75
3 0.75
4 0.74
5 0.8
6 0.78
7 0.79
8 0.73
9 0.66
10 0.68
11 0.66
12 0.67
13 0.68
14 0.65
15 0.58
16 0.63
17 0.6
18 0.51
19 0.54
20 0.54
21 0.53
22 0.55
23 0.56
24 0.51
25 0.53
26 0.55
27 0.54
28 0.52
29 0.44
30 0.41
31 0.41
32 0.4
33 0.4
34 0.39
35 0.32
36 0.26
37 0.27
38 0.28
39 0.28
40 0.26
41 0.22
42 0.2
43 0.19
44 0.18
45 0.16
46 0.15
47 0.1
48 0.1
49 0.11
50 0.1
51 0.14
52 0.18
53 0.26
54 0.35
55 0.4
56 0.44
57 0.48
58 0.58
59 0.63
60 0.67
61 0.69
62 0.72
63 0.77
64 0.84
65 0.89
66 0.9
67 0.91
68 0.94
69 0.95
70 0.94
71 0.93
72 0.93