Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V6V1F7

Protein Details
Accession A0A1V6V1F7    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
152-195EKPKEEKPKEEKPKEEKPKEEKPKEEKPKEEKPKEEKKESKEEDAcidic
210-230DDKKDDPKKEAPKKDETEKNEAcidic
NLS Segment(s)
PositionSequence
123-228DKAGKKQEPDNKEENKKKDEPKEEEESKGEKPKEEKPKEEKPKEEKPKEEKPKEEKPKEEKPKEEKKESKEEDKEEKPKDDGSKENQDDKKDDPKKEAPKKDETEK
Subcellular Location(s) nucl 15.5, mito_nucl 12.999, cyto_nucl 10.332, mito 8, cyto_mito 6.999
Family & Domain DBs
Amino Acid Sequences MVFARRSLFRAATAAQSFRTSSVARQSAQLLGRRFKSTSGSYEPGRASSDLPWLAASAAVTVPMVFYLWPSSSEGHHDVHGDEHKDEHTKDDEVEKASDEKSEGSSEAAPEKEKTGAEDKGEDKAGKKQEPDNKEENKKKDEPKEEEESKGEKPKEEKPKEEKPKEEKPKEEKPKEEKPKEEKPKEEKKESKEEDKEEKPKDDGSKENQDDKKDDPKKEAPKKDETEKNEGESKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.28
4 0.27
5 0.25
6 0.27
7 0.2
8 0.2
9 0.28
10 0.31
11 0.29
12 0.31
13 0.31
14 0.33
15 0.37
16 0.4
17 0.36
18 0.37
19 0.41
20 0.42
21 0.41
22 0.37
23 0.38
24 0.35
25 0.36
26 0.38
27 0.39
28 0.36
29 0.41
30 0.4
31 0.35
32 0.34
33 0.29
34 0.23
35 0.2
36 0.25
37 0.2
38 0.19
39 0.18
40 0.16
41 0.15
42 0.14
43 0.12
44 0.07
45 0.06
46 0.06
47 0.06
48 0.05
49 0.05
50 0.04
51 0.05
52 0.03
53 0.04
54 0.06
55 0.07
56 0.08
57 0.1
58 0.11
59 0.11
60 0.16
61 0.18
62 0.17
63 0.17
64 0.17
65 0.16
66 0.18
67 0.21
68 0.18
69 0.16
70 0.16
71 0.17
72 0.19
73 0.19
74 0.18
75 0.17
76 0.16
77 0.17
78 0.18
79 0.19
80 0.18
81 0.18
82 0.16
83 0.15
84 0.15
85 0.14
86 0.12
87 0.1
88 0.1
89 0.1
90 0.09
91 0.09
92 0.09
93 0.09
94 0.11
95 0.11
96 0.1
97 0.1
98 0.11
99 0.11
100 0.11
101 0.12
102 0.14
103 0.15
104 0.15
105 0.18
106 0.18
107 0.18
108 0.2
109 0.18
110 0.15
111 0.2
112 0.24
113 0.23
114 0.25
115 0.29
116 0.36
117 0.39
118 0.44
119 0.46
120 0.49
121 0.56
122 0.62
123 0.6
124 0.6
125 0.62
126 0.64
127 0.65
128 0.66
129 0.63
130 0.61
131 0.65
132 0.61
133 0.56
134 0.52
135 0.46
136 0.41
137 0.42
138 0.36
139 0.31
140 0.32
141 0.38
142 0.47
143 0.49
144 0.54
145 0.55
146 0.65
147 0.73
148 0.77
149 0.77
150 0.74
151 0.79
152 0.81
153 0.81
154 0.79
155 0.76
156 0.79
157 0.81
158 0.81
159 0.79
160 0.76
161 0.79
162 0.81
163 0.81
164 0.79
165 0.76
166 0.79
167 0.81
168 0.81
169 0.79
170 0.78
171 0.81
172 0.81
173 0.84
174 0.81
175 0.77
176 0.81
177 0.78
178 0.78
179 0.74
180 0.73
181 0.71
182 0.72
183 0.74
184 0.68
185 0.66
186 0.58
187 0.56
188 0.56
189 0.52
190 0.5
191 0.49
192 0.55
193 0.56
194 0.63
195 0.61
196 0.59
197 0.57
198 0.55
199 0.59
200 0.56
201 0.55
202 0.53
203 0.59
204 0.66
205 0.73
206 0.78
207 0.73
208 0.75
209 0.79
210 0.81
211 0.8
212 0.76
213 0.75
214 0.69
215 0.67