Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V6V8F1

Protein Details
Accession A0A1V6V8F1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
10-32HVGRDCSHQKWSRRNTPKFTISSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14, mito 6, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004304  FmdA_AmdA  
Gene Ontology GO:0016811  F:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides  
Pfam View protein in Pfam  
PF03069  FmdA_AmdA  
Amino Acid Sequences MAPKEWSNFHVGRDCSHQKWSRRNTPKFTISSGETVSFDAIDSSNGQLDTSSKASAIKTLDLELANPVFGPIYMNDAQPGDVLKVEVLDLEVADWGWSAIIPGFGLLADEFPEPEIKIWELNREAGFAQFKDMRIPLRPFLGCMGLAPATDEELSTVPPTNAGGNMDCRELSVGSTVFLPVQTAGALFSCGDGHAAQGHGEVCGTAIETPIRATLRFELLKNQPWMTAPQFQTPPRAQIPNPLPDLGTYGALGVAPDLYEATRSATRNLIQWLVQTKGLTRSEAYILASVAGDLHIAEVVNVPNYEVAMTLPLGIFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.43
3 0.51
4 0.54
5 0.55
6 0.65
7 0.72
8 0.74
9 0.78
10 0.84
11 0.83
12 0.85
13 0.84
14 0.78
15 0.71
16 0.65
17 0.57
18 0.52
19 0.46
20 0.38
21 0.3
22 0.27
23 0.24
24 0.18
25 0.15
26 0.12
27 0.1
28 0.09
29 0.09
30 0.1
31 0.11
32 0.11
33 0.11
34 0.1
35 0.11
36 0.14
37 0.15
38 0.14
39 0.12
40 0.14
41 0.15
42 0.18
43 0.19
44 0.18
45 0.17
46 0.18
47 0.2
48 0.18
49 0.19
50 0.17
51 0.16
52 0.13
53 0.12
54 0.1
55 0.08
56 0.07
57 0.08
58 0.06
59 0.12
60 0.13
61 0.13
62 0.14
63 0.14
64 0.15
65 0.14
66 0.14
67 0.09
68 0.08
69 0.08
70 0.07
71 0.07
72 0.06
73 0.06
74 0.05
75 0.05
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.05
96 0.05
97 0.05
98 0.06
99 0.07
100 0.07
101 0.07
102 0.08
103 0.07
104 0.1
105 0.11
106 0.15
107 0.15
108 0.18
109 0.18
110 0.17
111 0.17
112 0.17
113 0.18
114 0.13
115 0.16
116 0.15
117 0.15
118 0.16
119 0.17
120 0.16
121 0.2
122 0.23
123 0.2
124 0.23
125 0.23
126 0.21
127 0.21
128 0.2
129 0.15
130 0.12
131 0.13
132 0.08
133 0.08
134 0.08
135 0.07
136 0.06
137 0.06
138 0.06
139 0.05
140 0.05
141 0.06
142 0.06
143 0.06
144 0.05
145 0.06
146 0.06
147 0.06
148 0.06
149 0.06
150 0.07
151 0.09
152 0.1
153 0.1
154 0.1
155 0.09
156 0.09
157 0.09
158 0.08
159 0.07
160 0.07
161 0.06
162 0.07
163 0.07
164 0.06
165 0.06
166 0.06
167 0.04
168 0.05
169 0.04
170 0.04
171 0.04
172 0.04
173 0.05
174 0.04
175 0.04
176 0.04
177 0.04
178 0.05
179 0.05
180 0.05
181 0.06
182 0.06
183 0.06
184 0.07
185 0.07
186 0.06
187 0.06
188 0.05
189 0.05
190 0.04
191 0.05
192 0.04
193 0.05
194 0.05
195 0.05
196 0.06
197 0.08
198 0.09
199 0.09
200 0.11
201 0.12
202 0.18
203 0.2
204 0.2
205 0.24
206 0.28
207 0.35
208 0.36
209 0.35
210 0.3
211 0.29
212 0.33
213 0.29
214 0.33
215 0.28
216 0.31
217 0.36
218 0.36
219 0.42
220 0.39
221 0.41
222 0.37
223 0.4
224 0.34
225 0.38
226 0.43
227 0.42
228 0.43
229 0.38
230 0.33
231 0.29
232 0.32
233 0.24
234 0.19
235 0.12
236 0.1
237 0.09
238 0.09
239 0.08
240 0.05
241 0.04
242 0.04
243 0.04
244 0.04
245 0.04
246 0.05
247 0.06
248 0.1
249 0.14
250 0.15
251 0.17
252 0.21
253 0.23
254 0.26
255 0.28
256 0.27
257 0.23
258 0.26
259 0.29
260 0.27
261 0.28
262 0.24
263 0.24
264 0.29
265 0.3
266 0.28
267 0.24
268 0.25
269 0.25
270 0.26
271 0.25
272 0.18
273 0.17
274 0.16
275 0.15
276 0.11
277 0.09
278 0.08
279 0.06
280 0.05
281 0.05
282 0.05
283 0.05
284 0.05
285 0.08
286 0.09
287 0.11
288 0.11
289 0.11
290 0.11
291 0.11
292 0.11
293 0.09
294 0.08
295 0.08
296 0.08
297 0.09