Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V6UUI1

Protein Details
Accession A0A1V6UUI1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
221-242LKQSRESYPKHKPKEIKGYPEFHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 19, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR015942  Asp/Glu/hydantoin_racemase  
Gene Ontology GO:0036361  F:racemase activity, acting on amino acids and derivatives  
GO:0006807  P:nitrogen compound metabolic process  
Pfam View protein in Pfam  
PF01177  Asp_Glu_race  
Amino Acid Sequences MQISIIQPITTPVDLDSQELEGLCKNGITCSVVNLHTGPCSVESRTDKAFAIPGMIAAAQREVQNGVDAIVIDCFGDPGLDVLREVVDIPVLGVAQTSMNICASLADTFGVVTILKESIPIITDAVNAYGHKGRFVGCRAIDMRSLEIKGQVNEMTNRLAEQALSLVRDQNAHSIILGCTGFIGCAEEIRKRLELSGFNVPVVDPLPVTVFSAIPLLQMGLKQSRESYPKHKPKEIKGYPEFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.18
4 0.15
5 0.16
6 0.15
7 0.15
8 0.12
9 0.13
10 0.11
11 0.11
12 0.1
13 0.1
14 0.11
15 0.14
16 0.12
17 0.14
18 0.18
19 0.18
20 0.19
21 0.19
22 0.19
23 0.16
24 0.16
25 0.15
26 0.14
27 0.15
28 0.15
29 0.21
30 0.24
31 0.27
32 0.29
33 0.3
34 0.28
35 0.27
36 0.28
37 0.2
38 0.18
39 0.14
40 0.12
41 0.11
42 0.11
43 0.1
44 0.08
45 0.09
46 0.08
47 0.08
48 0.09
49 0.09
50 0.09
51 0.1
52 0.09
53 0.09
54 0.08
55 0.08
56 0.07
57 0.06
58 0.06
59 0.05
60 0.05
61 0.04
62 0.04
63 0.03
64 0.03
65 0.04
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.06
73 0.05
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.03
80 0.03
81 0.03
82 0.03
83 0.04
84 0.04
85 0.04
86 0.05
87 0.05
88 0.05
89 0.05
90 0.05
91 0.05
92 0.05
93 0.05
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.03
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.06
113 0.06
114 0.06
115 0.07
116 0.1
117 0.1
118 0.1
119 0.1
120 0.11
121 0.14
122 0.16
123 0.19
124 0.16
125 0.2
126 0.21
127 0.22
128 0.23
129 0.2
130 0.2
131 0.17
132 0.18
133 0.14
134 0.17
135 0.18
136 0.16
137 0.17
138 0.16
139 0.16
140 0.17
141 0.17
142 0.15
143 0.13
144 0.13
145 0.12
146 0.11
147 0.08
148 0.07
149 0.08
150 0.07
151 0.09
152 0.09
153 0.1
154 0.1
155 0.12
156 0.12
157 0.14
158 0.14
159 0.13
160 0.13
161 0.13
162 0.12
163 0.14
164 0.13
165 0.09
166 0.08
167 0.08
168 0.08
169 0.06
170 0.08
171 0.05
172 0.08
173 0.1
174 0.13
175 0.15
176 0.18
177 0.2
178 0.18
179 0.21
180 0.23
181 0.24
182 0.26
183 0.34
184 0.32
185 0.3
186 0.3
187 0.27
188 0.24
189 0.21
190 0.17
191 0.07
192 0.07
193 0.09
194 0.09
195 0.1
196 0.1
197 0.09
198 0.09
199 0.11
200 0.1
201 0.09
202 0.09
203 0.08
204 0.08
205 0.09
206 0.12
207 0.16
208 0.17
209 0.19
210 0.21
211 0.27
212 0.32
213 0.37
214 0.43
215 0.49
216 0.58
217 0.65
218 0.72
219 0.74
220 0.79
221 0.84
222 0.84
223 0.83