Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V6UU36

Protein Details
Accession A0A1V6UU36    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
82-102IDPGCKVKFFRDKRCSRHAMIHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, E.R. 7, golg 3, mito 2, plas 1, pero 1, vacu 1, cyto_mito 1, mito_nucl 1
Family & Domain DBs
Amino Acid Sequences MKLVQISLLTLTVLLPALTAGHPTARPPEEHESQPHKHHWSFDLFHNKHCSGTTISHEGQGSTGCRPNIENDGAQAFTNLHIDPGCKVKFFRDKRCSRHAMIEEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.04
4 0.06
5 0.06
6 0.07
7 0.07
8 0.09
9 0.09
10 0.11
11 0.17
12 0.17
13 0.18
14 0.23
15 0.29
16 0.31
17 0.33
18 0.39
19 0.41
20 0.43
21 0.47
22 0.46
23 0.45
24 0.43
25 0.42
26 0.38
27 0.36
28 0.34
29 0.37
30 0.43
31 0.38
32 0.4
33 0.44
34 0.41
35 0.36
36 0.34
37 0.28
38 0.2
39 0.21
40 0.21
41 0.2
42 0.2
43 0.22
44 0.21
45 0.19
46 0.17
47 0.16
48 0.14
49 0.12
50 0.15
51 0.13
52 0.13
53 0.14
54 0.16
55 0.19
56 0.2
57 0.18
58 0.16
59 0.18
60 0.18
61 0.17
62 0.15
63 0.11
64 0.09
65 0.11
66 0.09
67 0.09
68 0.09
69 0.09
70 0.11
71 0.17
72 0.18
73 0.17
74 0.19
75 0.26
76 0.36
77 0.44
78 0.54
79 0.58
80 0.66
81 0.72
82 0.81
83 0.8
84 0.74
85 0.76