Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V6U6Q7

Protein Details
Accession A0A1V6U6Q7    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
1-26ELRAANEKQKQKRTRSRRQIPAEEGLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 9, cyto 4
Family & Domain DBs
Amino Acid Sequences ELRAANEKQKQKRTRSRRQIPAEEGLSVQEASQLITEPVEAVEAPPPIGREGLRHLYNHERGHYQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.9
4 0.9
5 0.9
6 0.88
7 0.82
8 0.78
9 0.68
10 0.57
11 0.46
12 0.36
13 0.28
14 0.19
15 0.14
16 0.09
17 0.07
18 0.07
19 0.07
20 0.06
21 0.05
22 0.05
23 0.05
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.06
30 0.07
31 0.07
32 0.08
33 0.09
34 0.09
35 0.11
36 0.11
37 0.11
38 0.18
39 0.25
40 0.26
41 0.26
42 0.31
43 0.39
44 0.46
45 0.47
46 0.45