Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V6UFK9

Protein Details
Accession A0A1V6UFK9   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
67-93PPITRSSTSSRGRKKRRRPSGTYGDYAHydrophilic
NLS Segment(s)
PositionSequence
77-85RGRKKRRRP
Subcellular Location(s) plas 8, mito 6, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPMNSMLEPRQSSGGDNCPSTISGGGIAGIVIGSIAGTLLILWLWRIFRLPGAWSGGDTADVGYRPPITRSSTSSRGRKKRRRPSGTYGDYAEPTTVRSVRRYSNRDDLRRPAKVYMTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.32
3 0.3
4 0.29
5 0.28
6 0.26
7 0.25
8 0.24
9 0.2
10 0.12
11 0.09
12 0.09
13 0.08
14 0.07
15 0.06
16 0.05
17 0.04
18 0.03
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.03
31 0.04
32 0.04
33 0.05
34 0.06
35 0.06
36 0.07
37 0.08
38 0.09
39 0.1
40 0.13
41 0.13
42 0.12
43 0.12
44 0.11
45 0.1
46 0.09
47 0.07
48 0.05
49 0.05
50 0.05
51 0.05
52 0.06
53 0.06
54 0.08
55 0.1
56 0.14
57 0.16
58 0.21
59 0.27
60 0.35
61 0.42
62 0.49
63 0.57
64 0.63
65 0.73
66 0.78
67 0.83
68 0.85
69 0.89
70 0.89
71 0.88
72 0.87
73 0.87
74 0.82
75 0.74
76 0.67
77 0.58
78 0.49
79 0.42
80 0.33
81 0.22
82 0.17
83 0.18
84 0.17
85 0.17
86 0.2
87 0.24
88 0.32
89 0.41
90 0.45
91 0.48
92 0.56
93 0.64
94 0.68
95 0.71
96 0.73
97 0.72
98 0.73
99 0.69
100 0.63
101 0.6