Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4FAJ1

Protein Details
Accession A0A0C4FAJ1    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-33TQSNPPSSPTPKRNTKKPRARAISNNAEEHydrophilic
73-92EKTPTASAPKKTKKLKEEISHydrophilic
NLS Segment(s)
PositionSequence
15-49PKRNTKKPRARAISNNAEEPSKPSKKTKVAPRKTK
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MPSSTQSNPPSSPTPKRNTKKPRARAISNNAEEPSKPSKKTKVAPRKTKAATDAELQDDDDGNDADDVAKALEKTPTASAPKKTKKLKEEIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.64
3 0.7
4 0.76
5 0.8
6 0.84
7 0.85
8 0.86
9 0.88
10 0.85
11 0.85
12 0.84
13 0.82
14 0.81
15 0.73
16 0.66
17 0.56
18 0.48
19 0.41
20 0.36
21 0.36
22 0.3
23 0.3
24 0.31
25 0.37
26 0.43
27 0.51
28 0.57
29 0.6
30 0.66
31 0.74
32 0.74
33 0.75
34 0.7
35 0.65
36 0.58
37 0.51
38 0.42
39 0.35
40 0.32
41 0.25
42 0.23
43 0.21
44 0.17
45 0.13
46 0.12
47 0.1
48 0.08
49 0.06
50 0.06
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.06
57 0.06
58 0.07
59 0.09
60 0.09
61 0.12
62 0.14
63 0.19
64 0.24
65 0.29
66 0.37
67 0.46
68 0.55
69 0.63
70 0.7
71 0.74
72 0.77