Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4R820

Protein Details
Accession C4R820    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
25-54SEKHTRSNVKSSKPKNKTKPVGKVKHKDQGBasic
NLS Segment(s)
PositionSequence
27-53KHTRSNVKSSKPKNKTKPVGKVKHKDQ
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
KEGG ppa:PAS_chr4_0489  -  
Amino Acid Sequences MGCCVSKDSKGSSEGTNGLNEKRESEKHTRSNVKSSKPKNKTKPVGKVKHKDQGKPLGGDVPTQNGLSPKEAAALAAEKRQEKNVNGALGKKLHQERVKSNKKHLEELSQQKLQERKETPLVFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.28
4 0.27
5 0.26
6 0.29
7 0.27
8 0.26
9 0.28
10 0.3
11 0.33
12 0.41
13 0.48
14 0.51
15 0.6
16 0.66
17 0.64
18 0.71
19 0.71
20 0.71
21 0.72
22 0.74
23 0.75
24 0.75
25 0.82
26 0.81
27 0.85
28 0.86
29 0.85
30 0.86
31 0.86
32 0.87
33 0.87
34 0.85
35 0.81
36 0.8
37 0.75
38 0.68
39 0.64
40 0.63
41 0.57
42 0.49
43 0.43
44 0.39
45 0.34
46 0.31
47 0.25
48 0.17
49 0.15
50 0.14
51 0.14
52 0.11
53 0.12
54 0.12
55 0.12
56 0.1
57 0.1
58 0.1
59 0.09
60 0.08
61 0.1
62 0.09
63 0.11
64 0.14
65 0.15
66 0.16
67 0.21
68 0.24
69 0.23
70 0.29
71 0.31
72 0.33
73 0.32
74 0.33
75 0.32
76 0.3
77 0.3
78 0.3
79 0.3
80 0.33
81 0.37
82 0.4
83 0.47
84 0.56
85 0.65
86 0.63
87 0.69
88 0.7
89 0.7
90 0.72
91 0.65
92 0.63
93 0.62
94 0.67
95 0.65
96 0.6
97 0.57
98 0.55
99 0.57
100 0.52
101 0.51
102 0.45
103 0.44
104 0.5