Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4EHJ8

Protein Details
Accession A0A0C4EHJ8    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
24-44LDESSKPKKKTDNQHSNDQSAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR030616  Aur-like  
IPR011009  Kinase-like_dom_sf  
IPR000719  Prot_kinase_dom  
IPR008271  Ser/Thr_kinase_AS  
Gene Ontology GO:0032133  C:chromosome passenger complex  
GO:0000781  C:chromosome, telomeric region  
GO:0000939  C:inner kinetochore  
GO:1990385  C:meiotic spindle midzone  
GO:1990023  C:mitotic spindle midzone  
GO:0140602  C:nucleolar ring  
GO:0005524  F:ATP binding  
GO:0035175  F:histone H3S10 kinase activity  
GO:0004674  F:protein serine/threonine kinase activity  
GO:0051316  P:attachment of spindle microtubules to kinetochore involved in meiotic chromosome segregation  
GO:0120110  P:interphase mitotic telomere clustering  
GO:0033316  P:meiotic spindle assembly checkpoint signaling  
GO:1990758  P:mitotic sister chromatid biorientation  
GO:0007094  P:mitotic spindle assembly checkpoint signaling  
GO:0010971  P:positive regulation of G2/M transition of mitotic cell cycle  
GO:0090267  P:positive regulation of mitotic cell cycle spindle assembly checkpoint  
GO:1903380  P:positive regulation of mitotic chromosome condensation  
GO:1905824  P:positive regulation of mitotic sister chromatid arm separation  
GO:0140429  P:positive regulation of mitotic sister chromatid biorientation  
GO:0034501  P:protein localization to kinetochore  
GO:0006468  P:protein phosphorylation  
GO:1902412  P:regulation of mitotic cytokinesis  
GO:1904967  P:regulation of monopolar spindle attachment to meiosis I kinetochore  
Pfam View protein in Pfam  
PF00069  Pkinase  
PROSITE View protein in PROSITE  
PS50011  PROTEIN_KINASE_DOM  
PS00108  PROTEIN_KINASE_ST  
CDD cd14007  STKc_Aurora  
Amino Acid Sequences MTSRVLQRGSQIDQLENSLSNVRLDESSKPKKKTDNQHSNDQSAPASFSGTKAFSQSKNKPYALAPPPSAPSISNPASLANMGIGQYDGGFERDEASGRGSWDPGHKPENDTLDFEIPSPLYVIDHLLGQPSVKFIIALKCLYKRELVECKVEKQLRREIEIQSNLSEKRSSRYIAQMADALHYLHRKHVIHRDIKPENLLLGVEGELKIGDFGWSVHAPGNRRKLSAGSSLNALTLDYLPPEMVEGKDHNEKVDLWALGVLTYEFLVGVPPFEDLSGHNATYKKISKVEFSIPPTVSSEASDLIRKLLKHDPQDRLPLPQVANHPWILKYSKTRNEASGGGSNGAKTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.26
4 0.24
5 0.21
6 0.19
7 0.18
8 0.17
9 0.16
10 0.16
11 0.18
12 0.24
13 0.31
14 0.41
15 0.49
16 0.53
17 0.57
18 0.65
19 0.73
20 0.76
21 0.78
22 0.78
23 0.75
24 0.81
25 0.81
26 0.75
27 0.67
28 0.58
29 0.47
30 0.37
31 0.33
32 0.22
33 0.2
34 0.16
35 0.16
36 0.17
37 0.18
38 0.18
39 0.2
40 0.25
41 0.28
42 0.38
43 0.45
44 0.5
45 0.56
46 0.56
47 0.54
48 0.51
49 0.55
50 0.52
51 0.49
52 0.43
53 0.38
54 0.4
55 0.39
56 0.38
57 0.28
58 0.25
59 0.26
60 0.25
61 0.24
62 0.22
63 0.21
64 0.21
65 0.2
66 0.17
67 0.1
68 0.09
69 0.07
70 0.07
71 0.06
72 0.05
73 0.05
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.08
80 0.08
81 0.09
82 0.09
83 0.11
84 0.12
85 0.13
86 0.14
87 0.13
88 0.14
89 0.19
90 0.22
91 0.24
92 0.27
93 0.26
94 0.29
95 0.32
96 0.37
97 0.32
98 0.31
99 0.29
100 0.27
101 0.26
102 0.23
103 0.2
104 0.14
105 0.12
106 0.11
107 0.09
108 0.06
109 0.06
110 0.07
111 0.06
112 0.07
113 0.07
114 0.07
115 0.07
116 0.07
117 0.07
118 0.06
119 0.07
120 0.06
121 0.06
122 0.07
123 0.11
124 0.13
125 0.15
126 0.16
127 0.2
128 0.21
129 0.22
130 0.23
131 0.2
132 0.24
133 0.3
134 0.31
135 0.35
136 0.35
137 0.37
138 0.42
139 0.45
140 0.42
141 0.39
142 0.44
143 0.38
144 0.4
145 0.4
146 0.36
147 0.39
148 0.39
149 0.35
150 0.29
151 0.3
152 0.26
153 0.24
154 0.22
155 0.16
156 0.15
157 0.16
158 0.17
159 0.16
160 0.2
161 0.22
162 0.21
163 0.22
164 0.21
165 0.19
166 0.18
167 0.17
168 0.12
169 0.1
170 0.11
171 0.11
172 0.11
173 0.16
174 0.16
175 0.2
176 0.28
177 0.35
178 0.4
179 0.44
180 0.51
181 0.48
182 0.49
183 0.46
184 0.38
185 0.3
186 0.23
187 0.18
188 0.09
189 0.07
190 0.07
191 0.06
192 0.06
193 0.05
194 0.05
195 0.05
196 0.05
197 0.04
198 0.04
199 0.03
200 0.04
201 0.07
202 0.07
203 0.08
204 0.11
205 0.14
206 0.17
207 0.24
208 0.33
209 0.31
210 0.32
211 0.32
212 0.31
213 0.32
214 0.37
215 0.33
216 0.25
217 0.25
218 0.25
219 0.24
220 0.22
221 0.18
222 0.11
223 0.08
224 0.08
225 0.06
226 0.06
227 0.06
228 0.06
229 0.07
230 0.07
231 0.07
232 0.09
233 0.1
234 0.14
235 0.2
236 0.21
237 0.21
238 0.21
239 0.21
240 0.22
241 0.25
242 0.21
243 0.15
244 0.15
245 0.15
246 0.13
247 0.13
248 0.1
249 0.05
250 0.05
251 0.05
252 0.04
253 0.04
254 0.05
255 0.05
256 0.05
257 0.05
258 0.06
259 0.06
260 0.06
261 0.07
262 0.07
263 0.12
264 0.14
265 0.14
266 0.17
267 0.18
268 0.19
269 0.26
270 0.3
271 0.29
272 0.31
273 0.33
274 0.34
275 0.38
276 0.44
277 0.44
278 0.44
279 0.47
280 0.43
281 0.42
282 0.4
283 0.37
284 0.3
285 0.25
286 0.21
287 0.16
288 0.18
289 0.19
290 0.17
291 0.18
292 0.21
293 0.2
294 0.23
295 0.3
296 0.35
297 0.42
298 0.51
299 0.55
300 0.58
301 0.67
302 0.64
303 0.62
304 0.59
305 0.55
306 0.47
307 0.45
308 0.45
309 0.41
310 0.43
311 0.39
312 0.37
313 0.31
314 0.35
315 0.33
316 0.33
317 0.37
318 0.44
319 0.5
320 0.54
321 0.57
322 0.56
323 0.57
324 0.53
325 0.49
326 0.46
327 0.39
328 0.36
329 0.33