Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V6UHG1

Protein Details
Accession A0A1V6UHG1    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
104-131KAGMSGLKKRDRRARKAKTKGGAAKVTKBasic
NLS Segment(s)
PositionSequence
110-132LKKRDRRARKAKTKGGAAKVTKP
Subcellular Location(s) nucl 17, cyto_nucl 14.333, cyto 7.5, cyto_mito 5.832
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MAPHLGHDEFFKSLTDLLSKTSQQVHGSVYLTQKALINVPGATTTNSQPSILIRATDGNTNAPNLKESKESRASKDKSQKIKLSTIVSPDDIEAFYVRYADVCKAGMSGLKKRDRRARKAKTKGGAAKVTKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.13
4 0.16
5 0.2
6 0.19
7 0.21
8 0.24
9 0.27
10 0.25
11 0.26
12 0.25
13 0.24
14 0.24
15 0.25
16 0.23
17 0.22
18 0.2
19 0.2
20 0.19
21 0.17
22 0.17
23 0.15
24 0.14
25 0.11
26 0.12
27 0.12
28 0.11
29 0.12
30 0.12
31 0.12
32 0.14
33 0.15
34 0.15
35 0.14
36 0.14
37 0.16
38 0.14
39 0.13
40 0.1
41 0.12
42 0.13
43 0.14
44 0.14
45 0.12
46 0.12
47 0.13
48 0.14
49 0.11
50 0.12
51 0.11
52 0.12
53 0.15
54 0.16
55 0.22
56 0.3
57 0.32
58 0.35
59 0.44
60 0.46
61 0.49
62 0.58
63 0.59
64 0.59
65 0.64
66 0.65
67 0.59
68 0.6
69 0.57
70 0.51
71 0.44
72 0.39
73 0.34
74 0.29
75 0.26
76 0.21
77 0.17
78 0.13
79 0.12
80 0.09
81 0.08
82 0.07
83 0.07
84 0.07
85 0.06
86 0.08
87 0.09
88 0.1
89 0.09
90 0.09
91 0.1
92 0.1
93 0.13
94 0.16
95 0.22
96 0.3
97 0.39
98 0.43
99 0.51
100 0.61
101 0.68
102 0.74
103 0.78
104 0.81
105 0.83
106 0.89
107 0.91
108 0.88
109 0.88
110 0.86
111 0.84
112 0.82