Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V6U6P7

Protein Details
Accession A0A1V6U6P7    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
11-37NKELRAANEKQKQKRTRSRKHIPAEEGHydrophilic
NLS Segment(s)
PositionSequence
20-30KQKQKRTRSRK
Subcellular Location(s) nucl 19, cyto_nucl 12.5, mito 4, cyto 4
Family & Domain DBs
Amino Acid Sequences MQGAILLAKENKELRAANEKQKQKRTRSRKHIPAEEGLSVQEASQLITELVEVDKAPPSPSRRSPSPALQPHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.32
3 0.36
4 0.42
5 0.49
6 0.57
7 0.61
8 0.71
9 0.74
10 0.75
11 0.8
12 0.82
13 0.84
14 0.86
15 0.88
16 0.87
17 0.88
18 0.85
19 0.77
20 0.71
21 0.62
22 0.53
23 0.42
24 0.32
25 0.24
26 0.16
27 0.13
28 0.1
29 0.07
30 0.06
31 0.06
32 0.06
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.06
41 0.08
42 0.09
43 0.11
44 0.16
45 0.21
46 0.28
47 0.36
48 0.43
49 0.46
50 0.52
51 0.56
52 0.6
53 0.66