Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V6UN11

Protein Details
Accession A0A1V6UN11   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
92-115AKGGRASTRKKPPGKKSPGNGETEBasic
NLS Segment(s)
PositionSequence
65-73KGGKKGGKA
88-109HAIAAKGGRASTRKKPPGKKSP
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR019626  Stress-induced_KGG_rpt  
Pfam View protein in Pfam  
PF10685  KGG  
Amino Acid Sequences MTLIRGSRIISRPLLGLLPSVQRAVNVGLWHRCSVATAPPPNRPHPNSGNFANRSHEELSGIGHKGGKKGGKATGVGGFRDMDPEKQHAIAAKGGRASTRKKPPGKKSPGNGETELEAEQRGRSHEPSVVPPGFEEWKTMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.2
3 0.18
4 0.16
5 0.17
6 0.17
7 0.17
8 0.16
9 0.14
10 0.16
11 0.16
12 0.17
13 0.15
14 0.18
15 0.22
16 0.24
17 0.25
18 0.24
19 0.21
20 0.2
21 0.2
22 0.22
23 0.25
24 0.31
25 0.34
26 0.42
27 0.46
28 0.5
29 0.57
30 0.52
31 0.52
32 0.52
33 0.53
34 0.5
35 0.51
36 0.53
37 0.48
38 0.46
39 0.43
40 0.37
41 0.35
42 0.31
43 0.27
44 0.19
45 0.16
46 0.17
47 0.15
48 0.15
49 0.12
50 0.12
51 0.13
52 0.13
53 0.16
54 0.16
55 0.15
56 0.17
57 0.19
58 0.19
59 0.19
60 0.19
61 0.21
62 0.2
63 0.19
64 0.18
65 0.15
66 0.13
67 0.17
68 0.16
69 0.12
70 0.13
71 0.16
72 0.16
73 0.16
74 0.17
75 0.15
76 0.16
77 0.18
78 0.17
79 0.16
80 0.16
81 0.16
82 0.18
83 0.21
84 0.24
85 0.3
86 0.39
87 0.47
88 0.55
89 0.64
90 0.72
91 0.79
92 0.85
93 0.84
94 0.82
95 0.84
96 0.8
97 0.76
98 0.68
99 0.58
100 0.49
101 0.41
102 0.34
103 0.24
104 0.18
105 0.13
106 0.13
107 0.13
108 0.15
109 0.17
110 0.19
111 0.21
112 0.24
113 0.27
114 0.31
115 0.38
116 0.35
117 0.32
118 0.31
119 0.33
120 0.32
121 0.29