Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4EI55

Protein Details
Accession A0A0C4EI55   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
117-164SNERDPKKPYKIPKIDRSKPEALGSKPKPYNRKQKKGENKWKETFRMAHydrophilic
NLS Segment(s)
PositionSequence
108-158ENGKKPAKESNERDPKKPYKIPKIDRSKPEALGSKPKPYNRKQKKGENKWK
Subcellular Location(s) cyto_nucl 13.5, nucl 13, cyto 12
Family & Domain DBs
Amino Acid Sequences MTTQKTLHPPNEAEEGEAEEDELEVVTEAPPRVLNKAQEDAIAIFKATKAAYLNAKNYDEMDILKSYLEQVISSFKVVQKFLPWKEILAKHSDGWNPYTERKHIKVLENGKKPAKESNERDPKKPYKIPKIDRSKPEALGSKPKPYNRKQKKGENKWKETFRMARVLMEVKDAIEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.24
4 0.22
5 0.18
6 0.11
7 0.1
8 0.09
9 0.08
10 0.05
11 0.04
12 0.05
13 0.05
14 0.08
15 0.08
16 0.09
17 0.11
18 0.12
19 0.17
20 0.2
21 0.24
22 0.26
23 0.3
24 0.3
25 0.28
26 0.28
27 0.25
28 0.23
29 0.19
30 0.14
31 0.1
32 0.1
33 0.11
34 0.09
35 0.1
36 0.09
37 0.12
38 0.19
39 0.23
40 0.27
41 0.29
42 0.3
43 0.29
44 0.28
45 0.27
46 0.21
47 0.17
48 0.16
49 0.12
50 0.11
51 0.11
52 0.1
53 0.09
54 0.09
55 0.08
56 0.06
57 0.06
58 0.09
59 0.1
60 0.1
61 0.11
62 0.12
63 0.15
64 0.15
65 0.15
66 0.17
67 0.23
68 0.24
69 0.27
70 0.25
71 0.23
72 0.29
73 0.32
74 0.28
75 0.26
76 0.26
77 0.22
78 0.25
79 0.26
80 0.22
81 0.2
82 0.21
83 0.2
84 0.23
85 0.25
86 0.25
87 0.28
88 0.3
89 0.35
90 0.36
91 0.39
92 0.42
93 0.5
94 0.55
95 0.57
96 0.59
97 0.57
98 0.54
99 0.5
100 0.49
101 0.46
102 0.46
103 0.45
104 0.51
105 0.58
106 0.6
107 0.62
108 0.64
109 0.64
110 0.64
111 0.65
112 0.64
113 0.63
114 0.72
115 0.77
116 0.78
117 0.82
118 0.82
119 0.82
120 0.8
121 0.74
122 0.66
123 0.63
124 0.59
125 0.53
126 0.55
127 0.52
128 0.53
129 0.55
130 0.58
131 0.62
132 0.65
133 0.72
134 0.72
135 0.8
136 0.79
137 0.84
138 0.89
139 0.91
140 0.93
141 0.93
142 0.91
143 0.9
144 0.88
145 0.82
146 0.8
147 0.75
148 0.69
149 0.66
150 0.58
151 0.51
152 0.47
153 0.46
154 0.38
155 0.34
156 0.3