Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3AZT2

Protein Details
Accession G3AZT2    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
109-131IKAGFVGLKKKEKKKSKKNKISKBasic
NLS Segment(s)
PositionSequence
116-131LKKKEKKKSKKNKISK
Subcellular Location(s) nucl 13, cyto_nucl 13, cyto 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG cten:CANTEDRAFT_102737  -  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MGRLNNGEFLTQVGDILTQNDGKSSIYLTQKRLSPALDLDEPDVNEGVESINDLSSNVVEHKFKSNTQEYPILIRIALGSNGSKQKVKLSTVVEINNLDQFWSDYSSVIKAGFVGLKKKEKKKSKKNKISK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.1
4 0.11
5 0.1
6 0.1
7 0.11
8 0.11
9 0.11
10 0.11
11 0.12
12 0.16
13 0.23
14 0.27
15 0.3
16 0.34
17 0.37
18 0.39
19 0.39
20 0.34
21 0.28
22 0.25
23 0.26
24 0.23
25 0.21
26 0.2
27 0.2
28 0.19
29 0.18
30 0.16
31 0.11
32 0.09
33 0.08
34 0.06
35 0.04
36 0.05
37 0.04
38 0.04
39 0.04
40 0.05
41 0.05
42 0.04
43 0.05
44 0.06
45 0.07
46 0.08
47 0.09
48 0.14
49 0.16
50 0.17
51 0.22
52 0.24
53 0.24
54 0.27
55 0.3
56 0.25
57 0.26
58 0.27
59 0.21
60 0.17
61 0.15
62 0.13
63 0.1
64 0.1
65 0.08
66 0.07
67 0.1
68 0.13
69 0.15
70 0.16
71 0.16
72 0.21
73 0.24
74 0.25
75 0.28
76 0.27
77 0.3
78 0.33
79 0.34
80 0.3
81 0.27
82 0.26
83 0.22
84 0.19
85 0.15
86 0.11
87 0.11
88 0.1
89 0.12
90 0.11
91 0.1
92 0.11
93 0.12
94 0.13
95 0.12
96 0.11
97 0.08
98 0.1
99 0.13
100 0.14
101 0.2
102 0.26
103 0.36
104 0.45
105 0.54
106 0.63
107 0.71
108 0.79
109 0.84
110 0.89
111 0.91