Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4FBW8

Protein Details
Accession A0A0C4FBW8    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
101-151AKESKERDPKKPYKIPKINRTKPAASGSKPKPYKRKPKKGENKWKETFRMABasic
NLS Segment(s)
PositionSequence
89-145KHIKVLEKNKHPAKESKERDPKKPYKIPKINRTKPAASGSKPKPYKRKPKKGENKWK
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
Amino Acid Sequences MVDTRSGKDHSANPPPTKRVLNKAQEDAIAIFKATKAAYLNAKNYDEMDLLKSYLEQVISSFKVVQKFLPWKEILAKHSDGWNPYTERKHIKVLEKNKHPAKESKERDPKKPYKIPKINRTKPAASGSKPKPYKRKPKKGENKWKETFRMARVLMEVKDAIDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.62
3 0.63
4 0.64
5 0.61
6 0.59
7 0.61
8 0.63
9 0.62
10 0.63
11 0.6
12 0.52
13 0.49
14 0.41
15 0.33
16 0.24
17 0.17
18 0.13
19 0.11
20 0.13
21 0.1
22 0.11
23 0.1
24 0.13
25 0.2
26 0.25
27 0.29
28 0.31
29 0.33
30 0.31
31 0.3
32 0.29
33 0.23
34 0.19
35 0.17
36 0.13
37 0.12
38 0.12
39 0.11
40 0.09
41 0.1
42 0.09
43 0.06
44 0.07
45 0.1
46 0.1
47 0.11
48 0.12
49 0.13
50 0.16
51 0.16
52 0.16
53 0.19
54 0.25
55 0.25
56 0.29
57 0.27
58 0.25
59 0.31
60 0.34
61 0.29
62 0.27
63 0.27
64 0.23
65 0.27
66 0.27
67 0.22
68 0.2
69 0.21
70 0.19
71 0.22
72 0.23
73 0.23
74 0.27
75 0.28
76 0.33
77 0.35
78 0.41
79 0.45
80 0.53
81 0.59
82 0.61
83 0.67
84 0.67
85 0.66
86 0.61
87 0.59
88 0.57
89 0.58
90 0.56
91 0.59
92 0.64
93 0.64
94 0.7
95 0.73
96 0.74
97 0.73
98 0.76
99 0.75
100 0.75
101 0.82
102 0.83
103 0.83
104 0.86
105 0.85
106 0.84
107 0.82
108 0.73
109 0.68
110 0.66
111 0.62
112 0.54
113 0.56
114 0.53
115 0.57
116 0.61
117 0.64
118 0.68
119 0.71
120 0.79
121 0.8
122 0.86
123 0.86
124 0.9
125 0.94
126 0.94
127 0.95
128 0.94
129 0.93
130 0.91
131 0.88
132 0.82
133 0.8
134 0.75
135 0.68
136 0.66
137 0.57
138 0.5
139 0.47
140 0.46
141 0.38
142 0.34
143 0.3