Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3AX08

Protein Details
Accession G3AX08    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
66-90HILARRPKTVKLPPKRKNQGPVLILHydrophilic
NLS Segment(s)
PositionSequence
72-82PKTVKLPPKRK
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000313  PWWP_dom  
KEGG cten:CANTEDRAFT_112378  -  
Pfam View protein in Pfam  
PF00855  PWWP  
PROSITE View protein in PROSITE  
PS50812  PWWP  
Amino Acid Sequences MSQSEDQVPRSPPEASPAPDNDNVVEKNHPNPPSDAFSPTSIVLAKVKGYPPWPAMVLDEMILPDHILARRPKTVKLPPKRKNQGPVLILPVRFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.31
4 0.32
5 0.34
6 0.34
7 0.35
8 0.29
9 0.28
10 0.27
11 0.24
12 0.24
13 0.21
14 0.23
15 0.29
16 0.3
17 0.27
18 0.28
19 0.29
20 0.31
21 0.31
22 0.3
23 0.25
24 0.24
25 0.24
26 0.22
27 0.19
28 0.14
29 0.13
30 0.11
31 0.1
32 0.09
33 0.1
34 0.1
35 0.11
36 0.12
37 0.14
38 0.14
39 0.15
40 0.15
41 0.14
42 0.14
43 0.13
44 0.12
45 0.09
46 0.09
47 0.07
48 0.07
49 0.06
50 0.05
51 0.04
52 0.06
53 0.07
54 0.12
55 0.15
56 0.19
57 0.26
58 0.29
59 0.32
60 0.39
61 0.49
62 0.54
63 0.62
64 0.7
65 0.71
66 0.81
67 0.87
68 0.86
69 0.85
70 0.84
71 0.82
72 0.75
73 0.71
74 0.68
75 0.63