Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4FCZ9

Protein Details
Accession A0A0C4FCZ9   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
25-54TDPSPSTSRPVKKSRKRVTRSQTKKPSTARHydrophilic
NLS Segment(s)
PositionSequence
34-48PVKKSRKRVTRSQTK
Subcellular Location(s) nucl 25.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MSSRRTWEETGALPDADNIKITNPTDPSPSTSRPVKKSRKRVTRSQTKKPSTARAVDLLIKNPDNPAPYPQQAQGSVPTTNTGLSTGPSNDNPSASTADLQSPTLNTQAAESMDINPWDPIPDESLQGIGPLQSSTNPPPPNVCTADSNHSPDTSAPNNPAHSLHQTVPDDSPGSGAARPKSPNLFTPASPTGPAQASSATKEQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.21
4 0.18
5 0.13
6 0.13
7 0.17
8 0.18
9 0.2
10 0.21
11 0.23
12 0.26
13 0.27
14 0.31
15 0.33
16 0.35
17 0.36
18 0.42
19 0.48
20 0.51
21 0.61
22 0.66
23 0.7
24 0.78
25 0.84
26 0.86
27 0.85
28 0.87
29 0.88
30 0.88
31 0.87
32 0.87
33 0.87
34 0.82
35 0.84
36 0.78
37 0.77
38 0.72
39 0.67
40 0.59
41 0.51
42 0.47
43 0.45
44 0.41
45 0.35
46 0.32
47 0.28
48 0.25
49 0.24
50 0.23
51 0.2
52 0.19
53 0.2
54 0.22
55 0.23
56 0.25
57 0.26
58 0.27
59 0.25
60 0.25
61 0.24
62 0.21
63 0.2
64 0.18
65 0.16
66 0.14
67 0.13
68 0.12
69 0.1
70 0.07
71 0.07
72 0.08
73 0.09
74 0.1
75 0.11
76 0.14
77 0.14
78 0.14
79 0.14
80 0.14
81 0.14
82 0.12
83 0.12
84 0.1
85 0.11
86 0.11
87 0.11
88 0.09
89 0.08
90 0.09
91 0.09
92 0.08
93 0.07
94 0.07
95 0.07
96 0.07
97 0.08
98 0.08
99 0.08
100 0.09
101 0.1
102 0.1
103 0.09
104 0.08
105 0.08
106 0.08
107 0.07
108 0.09
109 0.09
110 0.1
111 0.1
112 0.11
113 0.1
114 0.09
115 0.09
116 0.06
117 0.06
118 0.05
119 0.05
120 0.06
121 0.09
122 0.13
123 0.2
124 0.21
125 0.21
126 0.24
127 0.26
128 0.3
129 0.3
130 0.29
131 0.24
132 0.26
133 0.32
134 0.32
135 0.35
136 0.31
137 0.28
138 0.26
139 0.24
140 0.27
141 0.24
142 0.23
143 0.22
144 0.24
145 0.26
146 0.26
147 0.27
148 0.25
149 0.26
150 0.27
151 0.25
152 0.3
153 0.3
154 0.31
155 0.3
156 0.29
157 0.26
158 0.22
159 0.21
160 0.14
161 0.14
162 0.15
163 0.18
164 0.19
165 0.23
166 0.25
167 0.29
168 0.34
169 0.36
170 0.38
171 0.4
172 0.41
173 0.36
174 0.42
175 0.41
176 0.37
177 0.36
178 0.32
179 0.29
180 0.27
181 0.28
182 0.21
183 0.21
184 0.21
185 0.25