Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3BA45

Protein Details
Accession G3BA45   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
65-88AEIARIRREREEKRRRLEERAKELBasic
NLS Segment(s)
PositionSequence
69-83RIRREREEKRRRLEE
Subcellular Location(s) mito 14, nucl 9, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018625  Pet100  
Gene Ontology GO:0016020  C:membrane  
GO:0005739  C:mitochondrion  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
KEGG cten:CANTEDRAFT_115470  -  
Pfam View protein in Pfam  
PF09803  Pet100  
Amino Acid Sequences MFNRFISKITRTQLETGKFGFYLFTPILVMIYSGINSDEKFNLPGFWPDPATLNQIPKERHEIQAEIARIRREREEKRRRLEERAKELGITEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.43
3 0.38
4 0.35
5 0.3
6 0.26
7 0.22
8 0.15
9 0.16
10 0.13
11 0.12
12 0.1
13 0.1
14 0.1
15 0.09
16 0.09
17 0.05
18 0.05
19 0.05
20 0.05
21 0.06
22 0.06
23 0.07
24 0.08
25 0.08
26 0.09
27 0.1
28 0.1
29 0.1
30 0.1
31 0.12
32 0.11
33 0.11
34 0.11
35 0.1
36 0.12
37 0.13
38 0.17
39 0.17
40 0.19
41 0.22
42 0.26
43 0.27
44 0.27
45 0.34
46 0.31
47 0.33
48 0.33
49 0.31
50 0.29
51 0.34
52 0.34
53 0.28
54 0.29
55 0.28
56 0.27
57 0.29
58 0.33
59 0.36
60 0.44
61 0.53
62 0.61
63 0.67
64 0.75
65 0.83
66 0.8
67 0.82
68 0.82
69 0.82
70 0.79
71 0.77
72 0.69
73 0.59
74 0.55