Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V6N8X8

Protein Details
Accession A0A1V6N8X8    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-38GLSRSEKQPQSPFKPKKQQHTHSKMDQYLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 7.5, cyto_nucl 5.5, cyto 2.5, plas 2, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR005352  Erg28  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
Pfam View protein in Pfam  
PF03694  Erg28  
Amino Acid Sequences MPRLPPNILGLSRSEKQPQSPFKPKKQQHTHSKMDQYLAYLPQSEGFLPKWLFFVSVVSALNSLQAYTAPEYTSLLYSNGKVPATPLSGRIFGTWTFLSAVIRMTAAYNITNSVAYDLGMWTYGIALSHFIGELVFGNASLKGRFLNPLIVASGSLAWMFTQREAYLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.4
4 0.48
5 0.53
6 0.56
7 0.65
8 0.7
9 0.74
10 0.83
11 0.83
12 0.85
13 0.86
14 0.86
15 0.87
16 0.86
17 0.84
18 0.81
19 0.82
20 0.73
21 0.65
22 0.55
23 0.46
24 0.4
25 0.34
26 0.26
27 0.2
28 0.17
29 0.16
30 0.16
31 0.13
32 0.12
33 0.11
34 0.16
35 0.15
36 0.15
37 0.15
38 0.15
39 0.15
40 0.13
41 0.13
42 0.09
43 0.11
44 0.11
45 0.1
46 0.1
47 0.09
48 0.1
49 0.09
50 0.07
51 0.05
52 0.05
53 0.07
54 0.07
55 0.08
56 0.07
57 0.08
58 0.08
59 0.09
60 0.09
61 0.08
62 0.08
63 0.08
64 0.09
65 0.11
66 0.12
67 0.11
68 0.11
69 0.11
70 0.12
71 0.14
72 0.14
73 0.14
74 0.14
75 0.15
76 0.16
77 0.15
78 0.14
79 0.12
80 0.15
81 0.12
82 0.11
83 0.1
84 0.1
85 0.1
86 0.09
87 0.1
88 0.07
89 0.07
90 0.06
91 0.06
92 0.06
93 0.07
94 0.07
95 0.06
96 0.07
97 0.08
98 0.08
99 0.07
100 0.08
101 0.07
102 0.06
103 0.07
104 0.06
105 0.05
106 0.06
107 0.05
108 0.04
109 0.04
110 0.05
111 0.04
112 0.04
113 0.05
114 0.05
115 0.06
116 0.06
117 0.06
118 0.05
119 0.05
120 0.06
121 0.06
122 0.06
123 0.06
124 0.06
125 0.08
126 0.09
127 0.09
128 0.09
129 0.09
130 0.1
131 0.13
132 0.14
133 0.18
134 0.17
135 0.19
136 0.19
137 0.18
138 0.17
139 0.15
140 0.14
141 0.1
142 0.09
143 0.07
144 0.06
145 0.09
146 0.1
147 0.11
148 0.14