Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4FCT0

Protein Details
Accession A0A0C4FCT0    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
26-58SSFRVKDTKVNNKNEKKKPYKIPKVDRSNPKASHydrophilic
NLS Segment(s)
PositionSequence
38-72KNEKKKPYKIPKVDRSNPKASGSKPYEQKPKSGAN
Subcellular Location(s) nucl 14, cyto_nucl 11, mito 6, cyto 6
Family & Domain DBs
Amino Acid Sequences MKAAYLNAKNYDEMDLLKTYLKQVISSFRVKDTKVNNKNEKKKPYKIPKVDRSNPKASGSKPYEQKPKSGANKWKETLKMARVLMEVKDAIEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.17
3 0.16
4 0.17
5 0.16
6 0.15
7 0.18
8 0.17
9 0.15
10 0.16
11 0.22
12 0.25
13 0.29
14 0.29
15 0.31
16 0.33
17 0.33
18 0.37
19 0.38
20 0.45
21 0.49
22 0.58
23 0.63
24 0.7
25 0.79
26 0.82
27 0.83
28 0.8
29 0.8
30 0.81
31 0.81
32 0.82
33 0.82
34 0.83
35 0.83
36 0.85
37 0.85
38 0.84
39 0.8
40 0.76
41 0.69
42 0.63
43 0.57
44 0.48
45 0.49
46 0.45
47 0.45
48 0.45
49 0.49
50 0.55
51 0.52
52 0.55
53 0.5
54 0.55
55 0.56
56 0.6
57 0.62
58 0.6
59 0.68
60 0.67
61 0.68
62 0.61
63 0.58
64 0.57
65 0.52
66 0.51
67 0.43
68 0.43
69 0.39
70 0.38
71 0.33
72 0.29
73 0.24